Open Close
General Information
Symbol
Dmel\Cp7Fa-PB
Species
D. melanogaster
Annotation Symbol
CG33962-PB
FlyBase ID
FBpp0113070
Associated gene
Length (aa)
343
Theoretical pI
7.40
Predicted MW (kDa)
38.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLACKLLLALVMGMHCIQLLMAACVCSEKGTDYCQSCQGSTVIRPKPRYYEPSDVNLPPIGDNCWCSKQLIEPAQLPKTC
GKVRELFQYMNAFNNLLGRRMLEGAIEAKTLAAQRLAERLQRLERIDCFKRGTTPCKPTCSCQQISSDSSYASSSSSGSV
YGKIDYAAEKIVDNSPAADPISVSLAAQAGKAINVPEAKLAYGFAQKPVDGEKKVVFSNVPEENLFKLKSDVITLKKRTY
ATKQEDEEEYAEEEQEQEQSSDDEEAPQLTYKQLGYITEQYKNPKFRKISSSSSSYAYKDYKDSSESGYGKVAGKVSVDC
GFKPGRITSYRKSKREESDDGYY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0114578
1183
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0100003
1033
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0099518
293
External Crossreferences and Linkouts ( 1 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Cp7Fa-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)