Open Close
General Information
Symbol
Dana\GF24010-PA
Species
D. ananassae
Annotation Symbol
GF24010-PA
FlyBase ID
FBpp0127202
Associated gene
Length (aa)
392
Theoretical pI
7.70
Predicted MW (kDa)
45.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFYSNLRLCARRAIADSTTHAAAMDAKEVTRTLICRACLVLLGPEDVSYNLASEQDLAEKYFGCIGGDSGSMQRLQEDDH
QQHSQLVLKSICECCYHLVQKFYDFRRMCEESARNFEELLLDIDYYCVKDQDVAVVSLPDLDTPSDSNDSSSQKPPMDTP
CITNIEEVYIMEDDNTQQDLKQEKLPSLSQRKAAGERKRRTKYTLKCNQCQRGFYKASLLEAHMKQHEGINPYTCVLCGK
SYARANLLEEHLHKRHSSSPSAQETYPCTSCDKVYTAYRSLKYHFKKQHEPGNEKDPSQGPQHICEKCGKSFGRKAHLTR
HKWTHTSKDDLKYACEYCHKRFYTKENMLDHQKRLHGLQNPLRCQKCGSISSSWAELKEHLEKHKNPDYVVQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0128710
1599
Corresponding to OTHER polypeptides
Other Polypeptides
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
  • Dana_gnomon_100_5781657.p
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Name Synonyms
Secondary FlyBase IDs
    References (2)