Polypeptide Dwil\GK12154-PA

General Information
Symbol	Dwil\GK12154-PA	Species	D. willistoni
Annotation Symbol	GK12154-PA	FlyBase ID	FBpp0241297
Associated gene	Dwil\GK12154

Length (aa)	141	Theoretical pI	4.59
Predicted MW (kDa)	15.7

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MKAFIVLAALAAIAAPALGRTMDRCSLAREMSDLGVPRDQLDKWTCIAEH ESSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNAL LSDDITSSVRCAQKVLSQQGWSAWSTWHYCNGWLPSIDDCF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Dwil\GK12154-RA FBtr0242805 426
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • XP_002065981 DDBJ / EMBL / GenBank • EDW76967
Synonyms
	Dwil\GK12154-PA GK12154-PA
References ( 1 )
Research paper	Drosophila 12 Genomes Consortium et al., 2007, Nature 450(7167): 203--218 Evolution of genes and genomes on the Drosophila phylogeny. [FBrf0200326]