Open Close
General Information
Symbol
Dmel\sha-PB
Species
D. melanogaster
Annotation Symbol
CG13209-PB
FlyBase ID
FBpp0271851
Associated gene
Length (aa)
1633
Theoretical pI
7.38
Predicted MW (kDa)
180.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRLQSLPLLLLLAVVTLPPATPTSAARPLTHPRARNHYPSEDLAEEPLMPASLLLEELQQTNGQLVNLTRQHDGDTFHTS
GLSSACNADTCIGLSSGTASLVRSTGDGSGQGNEKIHQSIDGLNPATSSLGGGQMELLTRRLKLQKGRGQVANIDASGET
GCTCRCLPYQRAYREDLGICVDDIHECSLSPFVSGSSSEKIPFVFLPLKGQIIYPSREISFASIHTPVCAVTGAQYLGSN
GWSDLRNPIDTDYPFRMFRDEGRSFLLWLGEADLRQKMQGRLIVVHLVCRDMTVALNASNHVKGEPLMPPRNVHSPCVAF
RVNGSPVKYAHNVPEVFFQPANSTTLASTSDGMTMREYVVIGICSLLLGLIYVASVFLYLYMKKRKRHSSRHSLDNLTND
INYPKNDQVTYGAPFSRVGSIYSSNSMGLGNGNESNTRTSIGSLKEDMGIVKNNPLLQHFPQLSEREHNSGFASDISNSN
SECEMEEKIKTSVLVHPQLSKSPKPSGGTDNAAMDVDDFLQDNECLPAENVAVIDELMSEEKLENLRAMVSGNVRKKLYF
NPAYFEPHLLAEPPQAAIEFLQKIREVIAIAKYKMASKRYQPSLNIIPEEQHPESSSSSPMFNIPLQQSLAGKGMGDKRN
SIEQWLQSVPNSDATPAPKTLDRPAPPTAKKPSSGSPNKGSLRKEISAPKERPPPPPMQKSKADEGNAKSSSPAPSGPHS
SRSTGKSSPEQSPKPKTNVGSTYEGFSAFSVAANVYGFAETGGEIYNNPKFMLADSPAASLRSASSRSKSMKKRSEVLDQ
FAAANSTPTSLTSFDRQHYNMLRNMKAPEVIYDSLKREFAAHIPTPDYDSTIEKRIKDIYSSTQSSIPSVPTPDYSSLSR
KSLKQFQPDSPIYRRKSPQYLIVDYETDSLERLEPSKRKSSHSSSSPSSDVSSQLSPSLSTALPLEEEMEISHTVYDRMN
GFRKEGEMKKRLAAKHQHPHPGQQQRQKEAAARIKYDTPFRGSMTIEVEHEPPSDLERTDSDQFEPDTLDRKPKKQSFCD
ISAWDGHKPIDSDFSQISSLPDLSRQISPAPNQGIKPRTASFILRSSNSFRNLREIYESPLIAQDNIKYEKKVAQTPEEE
GRILTLEAKHSRRQRLMETSPTHSVMDITKVNKTTITISSPKPADKAPPTRPKVNQHYCPPLVQSKRPLPPPPPNSSEHQ
APDEDAYSLHSEITGTSEFENSCNNTMSSAISATTEERTHAKGSRSPKINAKIPEEDYEGMYNKKINSLRNDYSLTKYLN
RRKSQREEVSKAGPDSPKDVAPEPEFGGSNKSVKEVDVAQFDALSISSRSNRSSSHLSERTKEMYRNAGVPVGIAYPQRA
ASSSGNASAGGNVQTVYRCEIEQAQLTAGMQIAIGLKDRAKKAKDLKNAWRKFVTMAANKFSPSQSPAPTYGSKTAAGFL
EDDGIASIIEDAAQSAGMGQPGSQTYYEQRFGQLDSGYMSTDSTELYKRNVYDRYNFKMPCGRGQIIRVDTIEDNEEESG
PNDNRFEDLEHMVSPSHSRRSPENNAVVACDLSDAESDKTLTRSHSQTNSQERNVRGSTTTMSSYSSDENGRGRSTCCGS
SETDEETNAEDMWESGAESIETHSVLYKMIRKS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0273343
6113
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088120
5895
FBtr0332463
5871
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087221
1626
FBpp0304736
1618
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
sha-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)