Open Close
General Information
Symbol
Dmel\cher-PG
Species
D. melanogaster
Annotation Symbol
CG3937-PG
FlyBase ID
FBpp0288453
Associated gene
Length (aa)
2399
Theoretical pI
6.07
Predicted MW (kDa)
259.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEAERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSV
ALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINN
FTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNS
KLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYI
PKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHK
TSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYT
EGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLS
SGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTD
FHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNY
GGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYS
VEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRI
KAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQG
GLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMN
AATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKS
GCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADK
HIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVH
YVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGK
AMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREA
GDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTK
VVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNG
EPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTA
PGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNI
GISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGP
SKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFK
MPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGG
SGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYV
SPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVK
FNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRY
TPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGL
KKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0290014
8128
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089471
7561
FBtr0089473
3219
FBtr0290013
3602
FBtr0290015
3502
FBtr0303364
7500
FBtr0332167
3281
FBtr0337101
8067
FBtr0479929
8392
FBtr0479930
8377
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088478
2210
FBpp0088480
838
FBpp0288452
919
FBpp0288454
857
FBpp0292427
2240
FBpp0304476
838
FBpp0308015
2429
FBpp0428261
2577
FBpp0428262
2572
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
cher-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)