Polypeptide Dmel\CG42238-PB

General Information
Symbol	Dmel\CG42238-PB	Species	D. melanogaster
Annotation Symbol	CG42238-PB	FlyBase ID	FBpp0288745
Associated gene	Dmel\CG42238

Length (aa)	100	Theoretical pI	10.32
Predicted MW (kDa)	9.8

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MLMPVREYNKHIAKIPNCKMRQRPTLRATFASLLLLLLIAQTLDLAAASG SAGSGAAAAGAAGPAASGGAGGGSLSSGAPTLIANLTEQGSPGVYNSTMG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG42238-RB FBtr0290306 2408
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG42238-RA FBtr0290305 2437 CG42238-RC FBtr0331199 3589 CG42238-RD FBtr0331200 2336
Other Polypeptides
	Name FlyBase ID Length (aa) CG42238-PA FBpp0288744 148 CG42238-PC FBpp0303626 100 CG42238-PD FBpp0303627 100
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001137846 DDBJ / EMBL / GenBank • ACL83052
Synonyms
	CG42238-PB
References ( 0 )
	No references are recorded in FlyBase at present.