Open Close
General Information
Symbol
Dmel\Tlk-PG
Species
D. melanogaster
Annotation Symbol
CG34412-PG
FlyBase ID
FBpp0288856
Associated gene
Length (aa)
1489
Theoretical pI
9.62
Predicted MW (kDa)
162.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSCTPSPLCGSFALAMLQQQQQQLEIREAQQRQQQKSRLQLNNYYKDIPRNQHHMQNCQDFLQVQQTVEINKLHFVQKTQ
QQECYMQQIHHHQQQQQKQIVDYQRVNERAHMQPTQILQSQQKISELQQIQRSARKPELLQIPEILQKQQFQTAQQKQTK
KQGANTATITSFNSNSNSNNSSSSCKNYNTTSNSNKNNIDNNSSNSSGQIMLASASASASARKRSRSTSNGSKSNNKTAS
GRIFTKSMSPGAHLQMSPQNTSSLSQHHPHQQQQLQPPQQQQQHFPNHHSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQ
HLQHLHKHPHQLQLHQQQQQQLHQQQQQHFHQQSLQGLHQGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPGAAAAAIQQ
QHPAFAPTLGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCATSADEAGSGGGSGGAGA
TVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSGVGAGGAGSGGGGAGSGSGSGGGKSARLMLPVSDNKKINDYFN
KQQTGVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
QTQTSQQQQQQQPGSDFHYVNSSKAQQQQQRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLSQQQQQQQQQQQQQQ
LGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVGVNVGVGPPLPPPPPMAMPAAIITYSKATQTEVSLHELQEREAE
HESGKVKLDEMTRLSDEQKSQIVGNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGAT
FQENWTDGYAFQELSRRQEEITAEREEIDRQKKQLMKKRPAESGRKRNNNSNQNNQQQQQQQHQQQQQQQNSNSNDSTQL
TSGVVTGPGSDRVSVSVDSGLGGNNAGAIGGGTVGGGVGGGGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGN
VGNSGGVGDRLSDRGGGGGGIGGNDSGSCSDSGTFLKPDPVSGAYTAQEYYEYDEILKLRQNALKKEDADLQLEMEKLER
ERNLHIRELKRILNEDQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHAL
REYNIHKALDHPRVVKLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYD
LKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFY
QCLYGKKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIPKHGRGS
LNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMNQSSSS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0299581
7243
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0112680
4624
FBtr0070596
5849
FBtr0299579
5537
FBtr0299580
6513
FBtr0299582
5890
FBtr0299583
4673
FBtr0301659
4882
FBtr0333751
7403
FBtr0333752
4308
FBtr0333753
7490
FBtr0345319
4355
FBtr0479803
5890
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0111592
1463
FBpp0099673
1254
FBpp0288854
1255
FBpp0288855
1266
FBpp0288857
1266
FBpp0288858
1242
FBpp0290873
1266
FBpp0305893
1265
FBpp0305894
1011
FBpp0305895
1242
FBpp0311479
1242
FBpp0428136
1276
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Tlk-PG
tlk-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)