Open Close
General Information
Symbol
Dmel\ATP8A-PH
Species
D. melanogaster
Annotation Symbol
CG42321-PH
FlyBase ID
FBpp0289035
Associated gene
Length (aa)
1350
Theoretical pI
7.04
Predicted MW (kDa)
152.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSGSYQRQSLELRSPDHGSVDDPDGCLRNHLGSSASQRRRQQRIAQQRQDSWFRHSMPPAINRDFESLEHLTPRASDGLD
EQLAASVSHSVHSGGSVTLCGPPDHSSIHLNSANSNLGFIDSDTPNTPVTPVSGLQPPASVSTSVGGTLSSRRRSSNRKD
SKGSILSRQSGKSRVSLLAQRGLRMTASFLRRKRTEYEDDEDFTSSAGYDADDGERRIINLNGPQPTKYGNNRITTAKYS
FISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDS
GSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIE
CELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILM
LFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLGYNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEM
YHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQNILGRHETSAVIEEFL
ELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIV
RTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESK
LEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDAT
REVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQSTNAVTLAI
GDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVY
SGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLP
LAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFR
GMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSDSGFGYALGKLIRSS
HILISHDHHPVSESSRTSNLRVENLEMEADTEQQQQSRQRQKWRGGQVATGVARSARNSTTSPITATLHM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0299757
5566
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0299754
4365
FBtr0299755
5273
FBtr0299756
4974
FBtr0299758
4655
FBtr0299759
4658
FBtr0299760
4552
FBtr0299761
4261
FBtr0299762
4553
FBtr0299763
4787
FBtr0299764
5080
FBtr0299765
5460
FBtr0303100
4930
FBtr0306698
3980
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289032
1150
FBpp0289033
1324
FBpp0289034
1216
FBpp0289036
1095
FBpp0289037
1176
FBpp0289038
1091
FBpp0289039
1150
FBpp0289040
1275
FBpp0289041
1275
FBpp0289042
1301
FBpp0289043
1265
FBpp0292219
1082
FBpp0297637
1127
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
ATP8A-PH
CG42321-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)