Open Close
General Information
Symbol
Dmel\kis-PC
Species
D. melanogaster
Annotation Symbol
CG3696-PC
FlyBase ID
FBpp0289115
Associated gene
Length (aa)
5517
Theoretical pI
5.34
Predicted MW (kDa)
593.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDGNAQNMFHGNHQGDPYYRYDAAAAAAAAAAANPRAMGPPGGYPPRHRPPHPLQQQPQYPSYQPTAENLYGLGAADHQA
AMGLGVGVGVGAGMGDLSGWGAAPSVPGQAAAYPGAGLGAYGHPQAAPPSQQQRQSNASAYRQHMPAYGQQDQQKLASYG
AQQSMMAGYGSLAPQQQQQQQPPTPQQQQQAQQVQQQAQQQQQQQQQQSQQQARLPQHYPQAPGQHPLYPGVGAPTVQAG
QPPTPQAYAHSPYGSPMQHQPSRGAPQHVGYGHTGLDQASAYGQHVPGGAPPGHHLSAQQQQAAQQLGAHQQQQLQSQQQ
QQAQQQQPHVSLMQQQQLPGAGLPPPHMGMPPSYGSHHQQQQQQQQTQQQQQQSAPPYMSSSKHQQAAAQLNSSPQYRAP
FPQLSPQMSPRPPTMSPHPQMSPRPVGVSPAKPPPPQQQQQQTQAQQPQQVVSNQPSQHSIQGMVGLPSPRPQPPTSGAG
GAGAKGPAPVAAPVNTLQALEQMVMPSQALGLPPMDYPSAYRSAVGPRMPASPQQQQQQHQQWGAAHGAQHLAALQQQQA
QQQQQQVQQQQQAPPQQQQQAAMLQAQQQHHQQQLSMYGQPMGQQPQTAQQQVVPPVTSQPPVVAASQQQQQQQHQQQSL
NDQLQHSINDIVGGGNSSGATGGAQNQHQQQPQLAAMSSPLHQQNLPNMHHLIQPTMETTQPTQQQQQTSQQQQQPQQPQ
ATLTSPHHQQMQHQSPIHQQQQSPHHQQHLPSYNQSQQQFDPFANILGDNQPAASQQTMSPAHVSSPVPAQMQQQQHQTQ
QQPSQQVPQSQQQQVSQPQQQTQQQQPSTPSHHLSSILNETANSNDSSTLAVAANDSNNSSSNSSTNSIVNNQPTSVHDS
NSQSSINSSSNNQQQLLMDNTNSHGGNSESAQNAGVDVGLFDNNSMSSNSAAVAAVASNAASAAAALLDSNSQSSNAEFE
KNQSEGEGLGVVEGVIANETDLPQDENSVSKTQDITLSTELPTIQDDLQEKPTAEMEQTQLGQSLGDLSKSLLEEPKTVE
ESGEDKSQSAPGVAPPADPIIPVTQPPQQQMPPIGMPMHPIAPGYEAQAQGQGHMPPMMPPYGGAPGMYPPYPMLHQQEI
AALQQQIQELYCMPPGHELQHQDKLMRMQERLNLLTQHEVNDQCAGGPQCLLFQNVPPMYGPPGNPLLNQQMVESPQVSS
TTGRGRGKSANKPRKPRAKKGEKAQVGQQQDLMDISGNVAMGAANAVSSIPTTQLPVSEDCVTQGAGDTSVVGMLEYSEG
MGDLSQDVHSANELDTSTDGSGKKKKPRKPRTPKDPNKPPRDRTPKAKKPKDPNDPNSTETPAAVKKRAGASKRRKQYGE
DGAEQTGEGSEVEDNKPLVPKAGSADGEAETTSGGTGVDGESPDYDDIPVSKIPRGSNEDEKEAEAGDETVDSVPDSAGD
PASTPSRRDRKRSTARSRRNANSEEGGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDTLDRTPPPSPPPDSEMDSNKR
RSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSANASNSNAGSDVEKTEPQSGAEGDAAQEVGEEKSNLPLDES
SQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGDEDSMVVQLVLAMRMGKRELILDKPKEKAPEPKQDEEKSE
LDEATTDKPEGDEKFKTEGESKKDLTDSEETKLESSAMEVDSKEESEPDDSKKSDEDNKDKDKMEVDDEVGKSDKESKPE
EQSETVKTEENSKAIEEDKSSTVLTADHAKEPETVLEKMEVDEKANDDQSAVSKAEGSDEKSTDDSNPEEATTEKNKESL
EIEGEKERVKEGEESVKKENDEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQ
SQQLNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQR
SEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPF
LVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNW
RLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQ
ALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLN
GAEEQIQYDFKSQHGEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRI
RGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTY
EREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM
ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRYGHEDVMELNSEESS
NENSDEEGGIGLRSRRRKEKRDRAREKKGNDEYIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFGWGRWSELLEL
GQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVS
TPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVL
LRVRMLYYIQHEVIGDFVQQIKDNTPISELPIRPPPTPDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVT
HVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDPERPSSSGKSSSENASGGND
KTESENDATTVSESSYKSEVLPGKGSDLDVSVAQQDALSATPELANTSDPKMNKNDAQVSASVSCDPADSSSPEAAGKAQ
GTGVQTGDAGELDIESEKKDNEKETKESTGDAPAVEAKKDSAAIARAEGDKTESCTNNATTNISTTTTTTTITNTTTTTN
NPSSKAANSNNTTDHANSNSHLGLDEEESVAGSYPPTVAAVEDATTMWPSMQDLNTRLRRVITAYQRNYKKEELKLQQKA
KLQALVSSTPPLSVPTTPTLQSMQMQLQSGSGSGGSGIGSSAQHDASGRSLQALMQSQGASTSAAAAAAASSAGGSCSGS
GQVGMGGAGVMPAMPTAADISLMLSILNTTDVNQLANLDINKLAMYLVSMNNKMERQGKMELAAKERESQRLQLIPKKWN
RREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAGLKLSESERGLE
GIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPN
FSFGESEKRFIRELEAQIQRTIKLEAFNAEKAEKLAAAEKDAATEKAAATEKAAAEKAASVKNEVIDLDDELMTNESVIK
KESPVTPIKEEIKSEESPEKHDTADNLEDKNSDAEESTKIKGKEDFNPETTEKEALDESTNLNKDKSSTETLVPEIEDSK
PSEDKMEVEELPVAENGEKEGSPEKCSDAEDKKFSEEKPSSPAVPDGKVSEMEADEAAPNTEENCSGDSESPEKECEDKV
VEKVEEEKGENSYEKAEEQKEETEKLEKSSIESEPSEKSETVLEPEVAVPKKSTGDQDILDLVAGPSDPDDDEVMKEKEK
AVEEECKKQAAELKARFPDLEVIQPATVKQQKLEKPKLEMCMIRWFKDFALERRIAHIVACVESGNWPVDSKYSAFATCK
GATDLSIALHESIPHLSSLERRSTTPDVITITTDQGVTKHLQTSHMQQVASSASAASTSSGVPQVTQSKPSSSNSLPGLD
AKSINAAVAAAVAAAAAGGNATSLSSLLPGMSLSAATGSSAGGVSGLSVPSAGSGVGKKRKRHIAIDVETERAKLHALLN
SSTMAPKDWESEIANMEALSGSSGRGRGGNSSASSGMQPPPAHQHASLSRQSSGQFSKPAVPAMKTPPPSMGAPMDLSSS
LPKMNMTEMLKSASSSGAIDLSEVQDFSMPSKKSSVHAALSSAFPSMGNKSKLDDTLNKLMKKNNCTIEEPVIGKEKKRK
KLDEIVLGLSAAKEQKTFPDPSLPSSKKPQIPPSVSVTPANLQSSSNQQSNQKPFTITVTTVPGKSKSGSSNSGSGTGGS
SSASGGGAGGSGLSALQNMAMGGLSSKDSLNALLAQTMATDPQTFLKQQQKMMQFLPPAQRKAYENMLAEMEQAMKISSK
FSTNSPHDVKVNKWLSDMTSPLGDQLSIDYVGGGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQH
SMPGPQNLTGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWLEQMQNPMSTPSPRPASMESGYGSSAVK
SHGGRPLSNLSSTSSSSHTQQQSSAAQSQAGGNSGSSKKNSRQQTAASAALDQAALQFGSLAGLNPSLLANLPGLGAFDP
KNPLAAFDPKNPLLSMSFGGMPGMGNIPGLGNLNNMNLFASLAGMGGLGNLAGMDTQSLAALMAAAGPTLGGLTGASGGA
GSGKSQAQSQSSATSSSSSASKKKQQQQQQQAQNEAAQLAAAISASTGGSGASGGKNAAASASQLAAGFPFLFPNPSLLY
PPMGLGGLNPYSLGSSGLGSAYDQLAQQYNLLNGATSSASNTSSTQSKSHQSQSKSSQSRNTTASANSAASLMNAMASMG
GGASTVTTPSTSASGSGRGRQSSSRNQSQTTPTAADMAQLSSLLMPGADPHLLESLSRMSNMDLAQATRLMSSLGMPPLS
GTPSSSGGGNTSTSKRSSQAANEANVQAKEQQKWLESLARGALPTDLAALQAFSQGKMPSTSGSNTGTSTSSSKSSKAAA
TAAAAQLPQIPGMSSDFPQAFLAEMAAQAMAAAGGSLPLSGPGSLASLAGLTGGSAGGGGSSASGSTSHSSSKRQREQDA
FKQQMDYYTKTLGLGSGISLIPTSSAGGSSASSSAANAAAAAYAAALDAEQQHQQQQKALSKRARGDLHPTKEELAALAA
GLPLNLGASMSSIEKSLRGGSSSSSSSTPAPMTAEQDKVTLTPLNASGGGSGSSSSSAAAAGLAANLPSQTTITIAPPIS
SGASTSSERSERSESRISLTITNAADAAKLPPPYEEADELIIQPILKKPTAANPGSSHGGSVDDLDTAENTSAANLSGSS
SSSAAAAAAAAAEENRRSSNRLKRPRSGNEQGSGSVEGQPPEKRRELRSTRHTRSSADASTLNLSTGSESGAEERNE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0299837
18528
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078144
17943
FBtr0078145
8225
FBtr0308253
18006
FBtr0308254
17733
FBtr0308255
17731
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077803
5322
FBpp0077804
2151
FBpp0300573
5343
FBpp0300574
5252
FBpp0300575
5191
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
kis-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)