Polypeptide Dmel\Pka-R1-PK

General Information
Symbol	Dmel\Pka-R1-PK	Species	D. melanogaster
Annotation Symbol	CG42341-PK	FlyBase ID	FBpp0289169
Associated gene	Dmel\Pka-R1

Length (aa)	376	Theoretical pI	4.82
Predicted MW (kDa)	42.2

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLR QYFQKLEREQVKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPV TEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFP VNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELAL IYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSI LESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQ RSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARF ERVLGPCADILKRNITQYNSFVSLSV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Pka-R1-RK FBtr0299891 2245
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Pka-R1-RAA FBtr0302641 3638 Pka-R1-RAB FBtr0302642 3580 Pka-R1-RAC FBtr0302643 3243 Pka-R1-RL FBtr0299892 2867 Pka-R1-RM FBtr0300528 3635 Pka-R1-RN FBtr0300529 3242 Pka-R1-RO FBtr0299893 3424 Pka-R1-RP FBtr0300530 3577 Pka-R1-RQ FBtr0300531 2423 Pka-R1-RR FBtr0300532 3315 Pka-R1-RS FBtr0300533 3068 Pka-R1-RT FBtr0300534 3240 Pka-R1-RU FBtr0300535 3570 Pka-R1-RV FBtr0302637 1648 Pka-R1-RW FBtr0302638 2426 Pka-R1-RX FBtr0302639 3245 Pka-R1-RZ FBtr0302640 3318
Other Polypeptides
	Name FlyBase ID Length (aa) Pka-R1-PAA FBpp0291781 377 Pka-R1-PAB FBpp0291782 377 Pka-R1-PAC FBpp0291783 377 Pka-R1-PL FBpp0289170 376 Pka-R1-PM FBpp0289755 376 Pka-R1-PN FBpp0289756 296 Pka-R1-PO FBpp0289171 463 Pka-R1-PP FBpp0289757 376 Pka-R1-PQ FBpp0289758 321 Pka-R1-PR FBpp0289759 319 Pka-R1-PS FBpp0289760 296 Pka-R1-PT FBpp0289761 376 Pka-R1-PU FBpp0289762 376 Pka-R1-PV FBpp0291777 464 Pka-R1-PW FBpp0291778 322 Pka-R1-PX FBpp0291779 297 Pka-R1-PZ FBpp0291780 320
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001014594 DDBJ / EMBL / GenBank • AAX52763
Synonyms
	CG42341-PK Pka-R1-PK
References ( 0 )
	No references are recorded in FlyBase at present.