Open Close
General Information
Symbol
Dmel\ATP8B-PB
Species
D. melanogaster
Annotation Symbol
CG14741-PB
FlyBase ID
FBpp0289580
Associated gene
Length (aa)
1726
Theoretical pI
7.67
Predicted MW (kDa)
193.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIGGRRCSEAARRLRRRPDTLELSVLGGQPIETELQEDNERTPTKGAGNVDEPGIEAPEASCSAPSKRTRWFQFARSSKN
RRKRLHCNEDEDVKQPERRNSDLEGSPRACLAQPEGMNIGSSTQTIATPLMIGDSFYSLAPGGGNPPPNKSDDQELYKQR
DPSVTSESKSVPSLRRLSQIRRRRSSYYFSENERRIRANDKEFNAQFKYHNNYIKTSKYSLFTFLPFNLLEQFQRLANFY
FLCLLVLQLIPAISSLTPVTTAIPLIGVLTLTAVKDAYDDIQRHISDSQVNNRKSKTLRNGKLVEAKWSEVQVGDVIRLD
NNQFVAADTLLLSTSEPNGLCFIETAELDGETNLKAKQCLTETIELGDRHDSLWNFNGEIICERPNNLLNKFDGTLIWRG
QRFALDNEKILLRGCVLRNTQWCYGVVVFAGVDTKLMQNSGKTQFKSTGVDRLLNFIIIGIVLFLVSICALFAIGCAIWE
GLIGQHFQLYLPWEHIIPKDYIPTGATVIGLLVFFSYAIVLNTVVPISLYVSVEVIRFVQSFLINWDEEMYYPTTNTYAK
ARTTTLNEELGQIQYIFSDKTGTLTQNIMTFNKCSINGRSYGDVIDLRTGELVEITEQQTIFQNSNTNNRPSPLSGAIVA
PPAAPPPIILVHKAEVHAKKTSMVVTSSGEAQVLPDRPRSDIERSAPPMDASEKRPGLKHVRYSAPSRSQDADAGRLSPR
LDGSGGLSPPVGNEERRISGGFKRSGAGCMQRQLSRTSSCDKVKILHDSQQTETHNMHHSSHNRKRLVKIRFKKAPSTAT
LGVVISQLEHHLDEEPQSTSTLSTTKHHHHRSKAFATNWSSSPHRVHALQSVDFSANPHHESDFRWYDRTLLDAVRSDEE
HSHVFFRLLALCHTVMAETVDGKLEYQAQSPDEAALVSAARNFGFVFRTRTPNSITIEVMGQTEEYELLNILDFNNVRKR
MSVILRRGDSMVLYCKGADNVIYDRLHGGQEDLKARTQDHLNKFAGEGLRTLALAERRLTEQYYNDWRSRQQEAALSMDS
REQKLNAIYEEIESEMQLVGVTAIEDKLQDGVPKSIANLQNAGIKIWVLTGDKQETAINIGYSCQLLTDELADVFIVDGN
SVEEVEKQLRQFKESIKIYNRFRPGGFDPFDRLNSDSNMDPLSVTMTQTSAFMQETNLPPTPPPPPAISVVTFRWDEKNK
DNKGGPDSAECNNLFGDEKGSEDGGTASIVVDENTGFALVVNGHSLVHCLSPELENKFLDIASQCKAVICCRVTPLQKAL
VVELIKRAKNAVTLAIGDGANDVSMIKAAHIGVGISGQEGLQAVLSSDYSIAQFRYLERLLLVHGRWSYYRMCKFLRYFF
YKNFAFTLCHCWYSLFCGFSAQTVFDPMFISVYNLFYTSLPVLALGVFEQDVSDKNSLEFPRLYTPGLKSELFNIREFIY
SVLHGAFTSLVLFLIPYGVYKDGVSANGFVVSDHMTLGAVVATILIVDNTAQISLYTSYWTVVNHVTIWGSLVWYFVLDY
FYNYVIGGPYVGSLTQAMKDLTFWVTMLITVMALVAPVLAYKFYLLDVHPSLSDKIRQKSLKKIHSRASSDVRRTASSRR
GRRSVRSGYAFAHQEGFGRLITSGKIMHKLPQDFAFPLGLGTKKTQVLHNNLNSADGPNSKGNNVTGHHMVNNNTNMRHN
QNQNHSSMADITADGRGNGGDDGRGSGGSDDMSPRAPCQDLDTINL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0300351
6697
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0307015
6500
FBtr0307016
6007
FBtr0339643
5810
FBtr0339644
6245
FBtr0339645
6458
FBtr0339646
6203
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0297858
1547
FBpp0297859
1496
FBpp0308705
1317
FBpp0308706
1462
FBpp0308707
1533
FBpp0308708
1448
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
ATP8B-PB
CG14741-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)