Open Close
General Information
Symbol
Dmel\mnb-PH
Species
D. melanogaster
Annotation Symbol
CG42273-PH
FlyBase ID
FBpp0289737
Associated gene
Length (aa)
1047
Theoretical pI
8.45
Predicted MW (kDa)
111.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSTALVYWQSMNGGDPVDKATADWAPFVVGAAAGGSFSSSIITSSSSSLNHHPHNGHHNHHHPPHYINYLAQIGCQHRVR
NWPTNGNQDQADDDDAGHQIISKFLPKSAWDTVLLDVKRDVDEDGDRDRDRVDGNVLMVQGSSSSSSRMKAERALYYTMS
AYGSSGGSVDAAQGSGSGGGRQRHAPLYGRFVDAEDLPATHRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLS
VDLIKTYKHINEVYYAKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKA
YDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRG
VSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGI
QYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGRKYK
PPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATNTSGAGATA
NAGAGGSGSSGAGGSSGGGVGGGLGASNSSSGAVSSSSAAAPTAATAAATAAGSSGSGSSVGGGSSAAQQQQAMPLPLPL
PLPLPPLAGPGGASDGQCHGLLMHSVAANAMNNFSALSLQSNAHPPPSLANSHHSTNSLGSLNHISPGSTGCHNNNSNSS
NNNTRHSRLYGSNMVNMVGHHNSGSSNNHNSISYPHAMECDPPQMPPPPPNGHGRMRVPAIMQLQPNSYAPNSVPYYGNM
SSSSVAAAAAAAAAAASHLMMTDSSVISASAAGGGQGGGNPGQNPVTPSAAAFLFPSQPAGTLYGTALGSLSDLPLPMPL
PMSVPLQLPPSSSSSVSSGSASVGSGGVGVGVVGQRRHITGPAAQVGISQSVGSGSSGSATGASSSDASSSSPMVGVCVQ
QNPVVIH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0300510
4228
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300508
5507
FBtr0299619
4460
FBtr0300509
4257
FBtr0342786
2978
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289735
908
FBpp0288894
607
FBpp0289736
604
FBpp0309627
743
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
mnb-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)