Polypeptide Dmel\n-syb-PG

General Information
Symbol	Dmel\n-syb-PG	Species	D. melanogaster
Annotation Symbol	CG17248-PG	FlyBase ID	FBpp0290116
Associated gene	Dmel\n-syb

Length (aa)	192	Theoretical pI	4.79
Predicted MW (kDa)	19.8

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIANKLGLIGGEQPPQYQYPPQY MQPPPPPPQQPAGGQSSLVDAAGAGDGAGAGGSAGAGDHGGV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) n-syb-RG FBtr0300894 3027
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) n-syb-RA FBtr0072815 1389 n-syb-RE FBtr0072819 1462 n-syb-RF FBtr0300893 1109 n-syb-RH FBtr0302310 1277 n-syb-RI FBtr0306578 3570 n-syb-RJ FBtr0331461 3411 n-syb-RK FBtr0331462 3378
Other Polypeptides
	Name FlyBase ID Length (aa) n-syb-PA FBpp0072697 183 n-syb-PE FBpp0089251 192 n-syb-PF FBpp0290115 183 n-syb-PH FBpp0291516 135 n-syb-PI FBpp0297533 135 n-syb-PJ FBpp0303878 206 n-syb-PK FBpp0303879 125
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_728645 DDBJ / EMBL / GenBank • AAF47530
Synonyms
	n-syb-PG
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]