Polypeptide Dmel\CG2082-PK

General Information
Symbol	Dmel\CG2082-PK	Species	D. melanogaster
Annotation Symbol	CG2082-PK	FlyBase ID	FBpp0290132
Associated gene	Dmel\CG2082

Length (aa)	364	Theoretical pI	8.57
Predicted MW (kDa)	40.1

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSIADKRASFARRAESLVERKYNISTEKCGDLTVIVQGDLSQQEKRAVFI TVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFP FPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLI LINATGSAASVVQSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQIVGE NPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVDVILIT GMLSPYASMVEKLHRDVEKERVTILKIERAGDVLADAPGKVAQSILLFCK GQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKPNI RRLSIMNSELPKKE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG2082-RK FBtr0300910 2290
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG2082-RA FBtr0078675 1863 CG2082-RB FBtr0078674 2280 CG2082-RC FBtr0078672 2281 CG2082-RD FBtr0078676 1059 CG2082-RG FBtr0300906 1872 CG2082-RH FBtr0300907 2287 CG2082-RJ FBtr0300909 2271 CG2082-RL FBtr0300911 2277 CG2082-RM FBtr0300912 1225 CG2082-RN FBtr0300913 1177 CG2082-RO FBtr0306153 1387
Other Polypeptides
	Name FlyBase ID Length (aa) CG2082-PA FBpp0078324 365 CG2082-PB FBpp0078323 364 CG2082-PC FBpp0078321 361 CG2082-PD FBpp0078325 201 CG2082-PG FBpp0290128 368 CG2082-PH FBpp0290129 363 CG2082-PJ FBpp0290131 361 CG2082-PL FBpp0290133 363 CG2082-PM FBpp0290134 211 CG2082-PN FBpp0290135 197 CG2082-PO FBpp0297283 335
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001163517 DDBJ / EMBL / GenBank • ACZ94816
Synonyms
	CG2082-PK
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]