Open Close
General Information
Symbol
Dmel\SKIP-PE
Species
D. melanogaster
Annotation Symbol
CG31163-PE
FlyBase ID
FBpp0290250
Associated gene
Length (aa)
1064
Theoretical pI
7.29
Predicted MW (kDa)
114.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASVYFMLNDPNS
LSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTPDGQRGHLEGLASVYCELLMAPFGDILATIERARQAAWAER
SPLHSAAQVVGGSGGAGGSTGSGSGGAASGGSGGSSGVLHHRQQHGHRGHSMHGAGLPNSHSQPIYVPGKYSPSSCLSDK
EEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQQLPIVPGQQQQGPHQHQTLPPNVAHLNF
VQQNCLSPRSAYFYEFPPTAEGRETKKRTTLARLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFE
ETIHRLKVQEAMRKKEKFQREHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGGNGGGGGAA
HYAVSALHHQGHWYDEPPYESDPDDFLMAGLNCGPAATIQGGRVRFSNNRESTGVISLRSAGDISLPQRGPPRRGLIVPQ
QPPNPPTIIPLTHARSHDRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTR
GHGCLPPSLLAAKAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDNTDRGSMSD
QAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKALVDSLPNPYDKEALKFKKGDLIDVLSMNA
SGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYED
LELFKELEPADLDYLGILNQEHRAKLLTAVQLLHDIECSDVDIPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYE
GSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTTLPGGGRLGKKSFLGGNGLMADDTLTRGG
LSEKSSDSGVSSSSLSSGPLKSST
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301028
5788
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0084197
5049
FBtr0305036
6584
FBtr0305037
6489
FBtr0310203
508
FBtr0330381
5049
FBtr0336712
6669
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083595
952
FBpp0293573
1064
FBpp0293574
1034
FBpp0301887
128
FBpp0303407
1080
FBpp0307693
1027
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG31163-PE
SKIP-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)