Open Close
General Information
Symbol
Dmel\CG42541-PD
Species
D. melanogaster
Annotation Symbol
CG42541-PD
FlyBase ID
FBpp0290322
Associated gene
Length (aa)
1417
Theoretical pI
7.84
Predicted MW (kDa)
155.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDTKLEARGQFPASFPDTFKNFFAMMNEDEDHVGLFANLLEDKVIPRQNSPVQPQRQRYGGSMRSHSGGDRSDRRGRTER
QYQQQIQNHHHHHQQQQQQQQQHQQQQQHQGAQQQRVFQSRSRSGSGSSVDLYANRNVSFSTTTNRVNSLRRNRSRGSLT
TLSSNGLNALGLGPVTLAPNVSSSSSGSVLDLTLPGGTGTGTVDGGGGGGGGGAGCGGQNVYPSPAKSNLKPALKATNSS
VDRGCALFVGVDGEFHCGHIKYCSLHHDNFADGLQQLQQQLKNQQLGSGQKHVTMACCECVCGSGKAARSGPDGEDNCGA
NYLKGYSGGYMLPPTPKGKSIDKTSTFTSAELAASKNKDLQERQERQEKRGSVILERAFDFDASCDESDSISSSTHNPVP
SPAPHQLAYNVLKPILKQPQQQQQQKAMLQAQHQQVNVQQHQGVTQQQYQQATHQQLGNQQHQVVTHQPHQQVTHQQHPG
GGVHQQHQVMVAHQAHAHTQVSNQQPVLQVQLPTPGVHVVHRLLPTPPTHSGKGAYHTRETALQRVQQQSGYYNQGPSTS
ASAYGYNQAMEQQQMQQQLHYDPHQELQFEQHQPHQSHQQQQLQHQQQHQLQHQQQHQQQQQYQQQQHQQQQHQQYADDT
ELDYDTEWELDEEPAPQIVPPLTTFNDFVNAAQNPTGSRSLRAQKSPILNRRRASSIAGNLLHSDYTYTRNSIGGAPIDS
NDFQRISHSSSARDRMSLAGVLTFQQAISGAVSPQYGTVGSLNSQVPATGEAGKPGIVGSDGIGGGGGGLPGGSSHNLNL
TVGLGFLGGSSTTLAAVAEVTSGPDGNGDSTDSPSPVSMIPSNQQKQQQQLLQLQLQQEQQHLPTHLPMKRERGVGESSG
ASTSGTAIAELASSVVLATQSGKPMTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGD
SLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDLSLD
DDYGQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVA
NKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQRLRLLTELELQRLNLQSTIQKHRGMH
LQTRRMVRQMSVCQGDEEIFDGGLPEGLQNGEANDDPDGVPSTSKASRSRIENPNRKPLNLESILKMGESEVDEDEDVVK
SSQLSKFNMLAASIRHRRPFRKRRSFDGGVTTSAAADAAAELQRRYQLRAMDDLQLEGRLAGATEERFGERSGLADSDDE
EDGEDIVNGGHRNACNRKVVKKLTARTKVFISSVLRFKKAISLKRRNSSSCSDLFVI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301100
8817
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0301099
6157
FBtr0332388
9704
FBtr0332389
8763
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0290321
1418
FBpp0304662
1417
FBpp0304663
1399
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG42541-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)