Open Close
General Information
Symbol
Dmel\bt-PF
Species
D. melanogaster
Annotation Symbol
CG32019-PF
FlyBase ID
FBpp0290554
Associated gene
Length (aa)
8933
Theoretical pI
6.07
Predicted MW (kDa)
1000.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGVAEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQPVGENKYTVVLELDDVVETD
AGLYKVKAKNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVK
ESERHKITVDKDVHSYFATLEILNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGIKPTFTERPVIRQSE
DGGNVTFECRCVGDPTPTVTWSHGETELNESNRYKMSLTMDQKLYHIACLEISSVVSSDQGEYRAQAKNKHGSGVATINL
NFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPDIVWYCSEKEICNNQRTKMTRKAITKDSYILTLEIQNP
TKEDGGNYRCNAINMYGESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPTVTWYRGQDLVEK
SKKIKINTTVIAEDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPEPEGEGPTFIEKPRIVSENNGKLV
IMECKVKADPKPDVIWFRNGEVIKESNKIKTFIEQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVP
VIKDKPKIIKIIKKRTVVIECTVASKFEPKCTWYKETSTVKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKLVAS
NEKGEAVSQIVNLVDIPEEERKPCKPEISRKLADQKVAESKTFELLVSLSQTDRKCKVEWYKGSTVIRETKDITTTFDGT
TARLTFSSARTEHTSNYKVIVTNEVGKDESSCKITVEKVAKKKEEKPKEKEKTKNEKEVEQKEMEEDKNESGQSVAQTEG
RINIEQISEGDPKEELTVKEEILDKRDTQEVKESSVELQDSAGHEVPEPKKATSDSKLDQSNQKNLDKKHKTDQSESKTN
KNVSLAEPIKSNKQESEEQQATEQIGLKKVDRKASIVSVKEEISSDVRRKSTIKAKEEITVDDKKASSRRSSLAVEESNT
ESRRSSIIDKKPLEQVDNKPIDANKNPQPLKEEIPRLKPAEKRRTSKVIEEPKPDEGLPKLRKASIAQVKEEAKPAAPKL
KAKAKAKPKYEELPEIPDYERPQLEKYEKSDFTPSDFARDLEIPNKMEKPIIDSGKKEPAVLAQKNGIPKKTDIIEQYAD
EPKGLKVGKGKLPDEGDGRDGAVLKPVIIEPEKEILDLGNKKNNQHADKPTVLDIIKQRRRSSIRNLMTKEPIQNESFLG
VVLKPVIKDTREQAAPQQAIQLTKANATEQFSPTKAVKAQVADLKKPETLATLEDNYERPVLEKYDPFSIDKTKSEKSTP
SIITPDIRGPEVKLPVQETKEEKQKVPKMQPPAPGDPPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIINDEKK
LRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYLTVGV
EGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAML
KKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKDEVF
TGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLECSVSSSMA
NVHWFKNNTKLESDDPRYLISKDINGNLKLIIKDSVLDDAGLYRCQLDKQPDKTECNLKVTEYPYKFVKVLKSQQCIEKD
TVTLACEIDDAMGEVQWLRNGEEIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQFKCTTNADTTESEIIINYQNRFNKKLK
DTEAVEREKLILDIELQDQTAPCDWKFNGEPIVPSESIEIKNMGGGKHQLIFSSLDMSNEGEITCESGQLSSKCKLSIRK
GESRPNIDCPDKFSGPISAPVLLEVPFKVSGTKQTPVEAKLFKDGKPLPVKDVEVAVTDDKVTFKIKKPSRDLSGPYQIK
ISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLSKKHGWESVAEVLPSEPCL
KKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVE
YKEKFSNDWVSGKEVDGDARTATVDGLKEGQQYEFRVRAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQ
TIRFDIKYDGEPEPAATWVKGTDNLKFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGTIESEAQVVVLDRPL
PPGGPFEPEEIRASHIKMKWKRPDDDGGCEISGYALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKE
GESEPLETFDAIVARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKTDDPNPEC
NVEGLKEKMVYQFRVRAVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVTIKSGRTHKWSVDVLGEPIPELHWSWRD
DIPLTNGDRIKIENVDYHTDFSITNVLRKDSGFYTLKAENRNGIDRETVELVVLGKPSSPKGPLAVSDVTASGCKLQWKK
PEDDGGVPIKEYVVEKMDTATGKWVRVGRSPGEKEPPSFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVVAKDPFDE
PNKPGTPEVTDYDNQSISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEIPGDQLEATVAGLQEYGEYQFRVIAVNK
AGLSPPSDASVPQIVKYKKLKPRIDRSNLKPLLIRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEIKNIPYN
TKISIIETVRKHTGIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISAYQVEKFD
KKQGRWVPLGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLDSDDSIIAKNPYDAASKPGTPNIVDYNEHMVKLK
WEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTNTSVPEATVEGLVEGNIYQFRVRAVNKAGFSDPSDATEPHLAKPRNL
KPYINRDKMKPIKVRAGQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVRLENIDYNTKLTLLDTDRKQSGQYKLRAENI
NGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVIEKMDTATGKWVPAGSVDPEKYDIEIKG
LDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDKD
SGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVNKAGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLD
INIRGEPAPKVEWFFNNSSVTSDEHSVKIDNVDYNTKFFVMRAQRSQSGKYIIKATNEVGEDEAELEVTVLGKPGKPKGP
LQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIGLHEGKAYKFRVRAVNKEGESEDLE
TEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDPPKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNGTVTGVEE
GHEYEFRIVAVNKAGPSDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEIKTSD
HIKIENEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLAVSNVTAETLHLKWEKPEDDGGDP
IEQYLVERMDTETGRWVPVLTTKTPEADVTGLTEGKEYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQIVDW
SGNHCDLKWRAPEDDGGASITGYIVERKDPNTGKWQKALETSTPDCKARVNDLIAGNKYQFRIMAVNKAGKSKPSEPSDQ
MTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSNYNIDMESYRTKLTVPISKRFHSG
KYTLKAENESGRDEASFEVIVLDKPGPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWLPSGRFKE
SFAELNNLEPSHEYKFRVLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPITGYV
VEKREKGTDKWIKGTEITIPCLGEECKATVPTLNENCEYEFRVKAINAAGPGEPSDASKPIITKPRKLAPKIDRKNIRTY
NFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTTSFSHIENLPYNTKYINNNPERKDTGLYKISAHNFYGQDQVEFQINI
ITKPGKPEGPLEVSEVHKDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLPVGRSDGPEYNVDGLVPGHDYKFRVKAV
NKEGESEPLETLGSIIAKDPFSVPTKPGVPEPTDWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPT
PTATVQGLIEGNEYQFRVVALNKGGLSEPSDPSKIFTAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWK
LSNYHLQSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPSPPNGPLQISDVHKEGCHLKW
KRPSDDGGTPIEYFQIDKLEPETGCWIPSCRSTEPQVDVTGLSPGNEYKFRVSAVNAEGESQPLVGDESIVARNPFDEPG
KPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEKQDKYGKWERALDVPADQCKATIPDLVEGQTYKFRVSAVNAAGT
GEPSDSTPPIIAKARNKPPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYNTKLKVN
SATRSDSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLDETTGRW
IPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEA
DGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVNKAGPGSPSDATETHVARPKNTPPKIDR
NFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVKISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRH
NVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNLIENHDYS
FRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWERAAV
VLGDNCKAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRP
LITWLYNGKEIGSNSRGESGLFQNELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDG
CHLTWNVPDDDGGSPILHYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAVNTIIAKNE
FDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYWTNVRHVPSNKNTTTIPELTEGQEYEFRVIA
VNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEVRIKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHS
VVHTVNCQRSDSGIYHLLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDL
THGGGWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPGKPELTDSDKNHITI
KWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLR
EKPRFYFDGLIGKRIKVRAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRISYETNSERTLFRIDDSNRRDSGKYTVTA
ANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTV
KNLVEGKKYVFRIRAENIYGASEALEGKPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRER
GGEWIKCNNYPTPNTSYTVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQRYRPDPPEPPKPDRITRNGVTLSWR
PPRTDGKSRIKGYYVEMRPKNGKDWKTVNDIPINSTVYTVPSLKEGEEYSFRVVAENEVGRSDPSKPSQPITIEEQPNKP
CMELGKVRDIVCRAGDDFSIHVPYLAFPKPNAFWYSNDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSG
FDTATINVRVLDRPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSSTWSKVSSFCTVPFVRIRNLVLN
KEYDFRVIAENKYGQSDPANTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKW
TKAVHALCPDLSCKIPNLIENAEYEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPY
HASPRPTASWSLNGLEVIPGERIKFDSNDYASMYYNKSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGPLNAY
DITPDTCTLAWKTPLDDGGSPITNYVVEKLDNSGSWVKISSFVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIEP
IVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYNLINGSEY
EFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAVWVKC
NDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGK
PSPTARWLRNGKEIQMNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLP
EGDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKSDGGPYQIEFTNESGSATGEFYVHI
TGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMA
VNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNATICA
ANQINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQNHNAQFTCTINGVPKPTIS
WYKGAREISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGEN
VVIKIPFTGFPKPRIHWVRDGENIESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPP
RFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYGRSDA
SDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDSYVFDIYSKFVPQPVEISQQSVYDRYDILEEIGTGAF
GVVHRCRERSTGNIFAAKFIPVSHSVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGY
VMTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNR
EPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLL
HPWLTGDHSAMKQEINRDRYLAYREKLRRKYEDFERFLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSS
QFCYEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYVGDDYYFIINRVKLDDRGEYIIRAENHYGSREEVVFLN
VQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLLCCLSGKPVPNVRWYKDGRELSKY
EYAMTHSDGVVTMEIIDCKPSDSGKYSCKATNCHGTDETDCVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQPIKPAPLP
IVTSRQYTSSSVQNTSEPQGDKVNVSNSNSSGISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKPEFTKPLHD
LTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSSSDILDLRYKNGIATLTINEVFPEDEGVITCTATNSVGAVETKCKLT
IQPLDKNINKRKVNAGDNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIA
EIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDETKQPSFVKFPTSVSVLEGEGTTFECEIDSELLNLVWLKDGKPIDE
TLPRYSFTKDGHRYSFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAES
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301340
27474
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089793
26619
FBtr0334482
25818
FBtr0334483
27666
FBtr0344988
26421
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088734
8648
FBpp0306552
8408
FBpp0306553
8866
FBpp0311242
8602
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
bt-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)