Open Close
General Information
Symbol
Dmel\par-1-PP
Species
D. melanogaster
Annotation Symbol
CG8201-PP
FlyBase ID
FBpp0290718
Associated gene
Length (aa)
1141
Theoretical pI
10.33
Predicted MW (kDa)
124.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEATTTTTPDLNRGDATRKSVRLYAARKGAAPAPPKLSVAPSSNQNSNHSSNNNNSSSNLPETEKEMELRQTHLANKDLD
GATEDDSIVELRRRDAQATPLPRIAVSALPTLQPHPTPKERQKPPMPRLLSTEDDAGVSFALGSIEKHIHNVEESFKQQQ
QNQQSQSSMDVMKLEIKRKQSKRYGETENLLRPGISDMSSENDFQYLGGRRAGELDDSNELMLSEFQRGSDGRNSIGAYS
KNSAAAANGANAVKAKLARTASDTKNNDTVLAMRATFKQKQHLQDEKQPAVWRPAGTGPTPAARSSSSTTSTSGSASRGG
SSSSVVDGVAPSKLTATTISASKRREENLRQFEALLAQKSSHRHGASGASGTGSNAASSKRRSDRPIVAPIPPYNSSRAE
HVTSSTRHSVDPRSHSGHESRSGTASTHPPVGHHPTSRVPSVVANRSNVYSNNAAQGSPNMQMRSSAPMRWRATEEHIGK
YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYA
SGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGS
PPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKR
ASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIGKTEALVAMGYNRSEIEASLSQVRYDDVFATYLLLGRKSTDPE
SDGSRSGSSLSLRNISGNDAGANAGSASVQSPTHRGVHRSISASSTKPSRRASSGAETLRVGPTNAAATVAAATGAVGAV
NPSNNYNAAGSAADRASVGSNFKRQNTIDSATIKENTARLAAQNQRPASATQKMLTTADTTLNSPAKPRTATKYDPTNGN
RTVSGTSGIIPRRSTTLYEKTSSTEKTNVIPAETKARNNTALEYSGTSGASGDSSHPGRMSFFSKLSSRFSKRPTIADEA
AKPRVLRFTWSMKTTSPLMPDQIMQKIREVLDQNNCDYEQRERFVLWCVHGDPNTDSLVQWEIEVCKLPRLSLNGVRFKR
ISGTSIGFKNIASRIAFDLKL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301503
4849
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0086450
4827
FBtr0086457
4868
FBtr0100390
4858
FBtr0100393
3321
FBtr0301504
3918
FBtr0301505
4840
FBtr0301506
4990
FBtr0330244
6079
FBtr0330243
3863
FBtr0330245
4827
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085646
938
FBpp0085653
993
FBpp0099804
833
FBpp0099807
357
FBpp0290719
1046
FBpp0290720
827
FBpp0290721
1058
FBpp0303277
951
FBpp0303276
832
FBpp0303278
1170
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
par-1-PP
Name Synonyms
Secondary FlyBase IDs
    References (0)