Open Close
General Information
Symbol
Dmel\shi-PL
Species
D. melanogaster
Annotation Symbol
CG18102-PL
FlyBase ID
FBpp0290811
Associated gene
Length (aa)
883
Theoretical pI
8.43
Predicted MW (kDa)
98.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLH
IKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIR
KETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGR
KDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIK
TKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFT
PDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELA
YMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLP
LDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQK
SASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESAT
RREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPST
GRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLPSRVSGAVGGAIVQQSGANRYVPESMRGQVNQAVGQAAINELSNAFSS
RFK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301596
3096
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074121
3990
FBtr0074118
4180
FBtr0074119
3878
FBtr0074122
3991
FBtr0074123
3191
FBtr0074124
3190
FBtr0111036
4309
FBtr0111037
4321
FBtr0301594
3380
FBtr0301595
3300
FBtr0301597
4198
FBtr0333717
3712
FBtr0333718
4768
FBtr0340413
3667
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0089278
830
FBpp0073928
830
FBpp0073929
830
FBpp0089279
830
FBpp0089280
877
FBpp0089277
877
FBpp0110335
830
FBpp0110336
830
FBpp0290809
877
FBpp0290810
877
FBpp0290812
836
FBpp0305866
896
FBpp0305867
834
FBpp0309359
881
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
shi-PL
Name Synonyms
Secondary FlyBase IDs
    References (0)