Polypeptide Dmel\RIC-3-PR

General Information
Symbol	Dmel\RIC-3-PR	Species	D. melanogaster
Annotation Symbol	CG30296-PR	FlyBase ID	FBpp0291116
Associated gene	Dmel\RIC-3

Length (aa)	472	Theoretical pI	6.66
Predicted MW (kDa)	51.5

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPATATSKPRAPLVEEGMTPKKTALIIVTVIGCIAILWPKVFHPMMFGGV PPSQPNFKDPRAAPGGLRQERPAHLHPESIYQAMRERGRAIPATPTVPIL ERKTSPSNPPPRIVDGRPGPIPGMRPPMGAGALHQPQQRGSSMGFLMPLY TIGIVVFFGYTLMKIMFKKQVPNDPYGAAPPNPAFRQEVFGSQNHSQVED LGGSKLGWREHQTRAATATAAAKKPAAKDTEKELYNASVSATEVASSLSA SLKSHQQLKEAEQLMEIEKLRQKLESTERAMAQLVAEMNTDQYEAKKNDN EKTREQPLDKQNLSNGHASSTDQNPEQETVAKGARKRRDLSAEQELTVLG MELTASCEGGHKWTGRPPTPVFRAPSEHSKLEDNLPEPQSIYLEGALAHE SQILVADSQIKREEVYDSELNGSAEEPAIILSSRMTLSLINLDANQQNGN AGKSAVESPLADDIEIIGHDEQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) RIC-3-RR FBtr0301902 2377
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) RIC-3-RC FBtr0071528 2516 RIC-3-RD FBtr0071527 2396 RIC-3-RE FBtr0113369 2444 RIC-3-RG FBtr0113371 2471 RIC-3-RH FBtr0301892 2369 RIC-3-RI FBtr0301893 2270 RIC-3-RJ FBtr0301894 2417 RIC-3-RK FBtr0301895 2177 RIC-3-RL FBtr0301896 2324 RIC-3-RM FBtr0301897 2276 RIC-3-RN FBtr0301898 2423 RIC-3-RO FBtr0301899 2249 RIC-3-RP FBtr0301900 2156 RIC-3-RQ FBtr0301901 2303 RIC-3-RS FBtr0310056 2374 RIC-3-RT FBtr0310057 2552 RIC-3-RU FBtr0342838 2127 RIC-3-RV FBtr0342839 2524
Other Polypeptides
	Name FlyBase ID Length (aa) RIC-3-PC FBpp0071457 505 RIC-3-PD FBpp0071456 465 RIC-3-PE FBpp0112281 481 RIC-3-PG FBpp0112283 505 RIC-3-PH FBpp0291106 456 RIC-3-PI FBpp0291107 423 RIC-3-PJ FBpp0291108 472 RIC-3-PK FBpp0291109 392 RIC-3-PL FBpp0291110 441 RIC-3-PM FBpp0291111 425 RIC-3-PN FBpp0291112 474 RIC-3-PO FBpp0291113 416 RIC-3-PP FBpp0291114 385 RIC-3-PQ FBpp0291115 434 RIC-3-PS FBpp0301757 505 RIC-3-PT FBpp0301758 342 RIC-3-PU FBpp0309664 425 RIC-3-PV FBpp0309665 336
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_995910 DDBJ / EMBL / GenBank • AAS64752
Synonyms
	CG30296-PR RIC-3-PR
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]