Open Close
General Information
Symbol
Dmel\shot-PQ
Species
D. melanogaster
Annotation Symbol
CG18076-PQ
FlyBase ID
FBpp0291176
Associated gene
Length (aa)
5155
Theoretical pI
6.38
Predicted MW (kDa)
588.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSNLRYRHETKRERTVEAVITDYPGVSPLGSVP
HERTNFERTVTFQDPTGNSRRLSETGALVPAGAIPTSSTHYQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIV
RKVTTLSRAEENAQPAEDLLPPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYIS
SLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERSFPPTLIEMKRLLSDLQRFRSDEVSARKREKS
KLIQIYKELERYFETVGEVDVEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
GRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKKVNKLHQRWAQLRTNFHTNLV
QKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQF
HTKILNDERQQTKFSGDELALYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFF
GEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQA
ICAYKQQGQLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREMDEVNRLFDEFEKRARAEEES
KQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKK
SLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGTTERL
SAMPTATSAYELDQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELRNQINALKQIKDEIESQQRPVATCLE
QIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDRVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERS
LSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVSLV
SAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGR
LVDNAQQALDNLLRSLGGQLSPMEINQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDK
FKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKFEKLYEKANKR
GEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVT
DTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKP
ICKDYRDYAPTIDKINDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRS
SQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERC
IKQARKILEDMYEKQSLLDTTKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLK
SWLDSKERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEIKLKDILGKWDD
LVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATL
CNILGDPASRADVNSRVAALEKQYLALQKKLDTKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQ
HQIDTHEPIYREVMAREHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSET
FLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLGETFLSSCDIDKEPIKAELQDIRDRWER
LNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALA
KDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREI
KIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDNRVRDHEDNLHSTLKALRE
FYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKD
LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDR
QNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVK
AMELIPTDEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALL
AESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDE
AIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPI
LDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREAD
LPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQ
ALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGA
KINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMD
DLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTL
KDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITAL
YAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVEL
TERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEV
ELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAE
VQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTL
KQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAM
LLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIE
EATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLE
EALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGNNPEV
GRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEKVSREMMDIHMDFMKDL
RVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEG
TLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVFKGSRDQGLNARKGSRIT
PTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRF
LKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKP
ANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRADEHLA
ELMPIFEKIRAQDQVPCAFPIHMGAGGTVFVRCNTSRSVPLSPHVLHCHPTTHWVRERSVRSIPMSRPSRSSLSASTPDS
LSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQRKPST
GSTASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIRRNISGSSTPSG
MQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0301964
16892
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087619
18014
FBtr0304850
17845
FBtr0304851
13661
FBtr0304852
17813
FBtr0304853
17148
FBtr0087616
17791
FBtr0087620
16907
FBtr0087618
17114
FBtr0087617
17776
FBtr0087621
27842
FBtr0273222
17746
FBtr0273223
17725
FBtr0273224
17731
FBtr0273225
17969
FBtr0273226
17948
FBtr0301591
17785
FBtr0301592
18008
FBtr0301593
17801
FBtr0304847
17729
FBtr0304848
18016
FBtr0304849
17803
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0086745
5501
FBpp0293390
5408
FBpp0293391
4100
FBpp0293392
5462
FBpp0293393
5434
FBpp0086742
5390
FBpp0086746
5160
FBpp0086744
5201
FBpp0086743
5385
FBpp0086747
8805
FBpp0271730
5375
FBpp0271731
5368
FBpp0271732
5370
FBpp0271733
5486
FBpp0271734
5479
FBpp0290806
5388
FBpp0290807
5499
FBpp0290808
5458
FBpp0293387
5434
FBpp0293388
5463
FBpp0293389
5394
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
shot-PQ
Name Synonyms
Secondary FlyBase IDs
    References (0)