Open Close
General Information
Symbol
Dmel\Oatp74D-PC
Species
D. melanogaster
Annotation Symbol
CG7571-PC
FlyBase ID
FBpp0291251
Associated gene
Length (aa)
819
Theoretical pI
7.29
Predicted MW (kDa)
88.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTKSNGDVEAAAQVQSLGGKPSNGHGQLNGNGYHQNGGRRDSSQAFTPLLSQHNNGTTNGEVTTPPPSTVLYESTPSNNN
EWKAPEDLGHLKNGLGNILSSNNNGTGNGHSLSEKYAHEQAPLTGGYKLPPRSSESEESDFDSDLNGGSSAESSSSCGLF
GCRPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSVITTIEKLFQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRP
RWIACGMVLFSIAAFSCALPHFIFGEQLMHSSVILQQTQVSPPNNSFSSHWLNASSEQVNPNLCILGGNQTHSGSECNEE
RQLEQASHSKITVIVLCIFFGSLLSSGIGQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYV
NFSNPGFDATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPPGQTATPAAPVEPEEKPKLKDFPKTVRRQLS
NDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANMIAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFT
ALVYSAGMIILMFIGCSMNDFAGYKPSDGNSPALIEPTCSAALNCTCDKENFAPICADGKMYISACHAGCSSSSLRPSDN
RTLYSDCACIPDAPEAVNGYCDNNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHPKDKAMAMGVIQSAIGLFGNVP
CPIIYGAVVDSACLIWKSVCGKHGACSLYDADTFRQYFLGITAGIMFLAFLMDLVVWRKAHRIDIAPEDPQEGGPASNGR
TLEVSESKQPITPAPDTTV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302041
3715
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0075173
3704
FBtr0345117
3658
FBtr0345118
4063
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074939
819
FBpp0311342
819
FBpp0311343
819
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Oatp74D-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)