Open Close
General Information
Symbol
Dmel\plx-PC
Species
D. melanogaster
Annotation Symbol
CG42612-PC
FlyBase ID
FBpp0291301
Associated gene
Length (aa)
1572
Theoretical pI
7.63
Predicted MW (kDa)
175.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MKTRLVSLTFRGSASVDPRYSASMLPWTINDIRSTESYTKLSVGIENGILESYNSDFELQFSHPLKHIVGMCRIIHKPQA
KSIGNGFLQLKSSAGQTSSSSAVASSMGGAASSSLTGNGLRHTLTASTSYGSLSSSAACAYQLQLQQSAEASAEQPQNFM
EFQGPITGLVYLLKDPKDPLLHIYLFECEAVEEMAELMHQMRDPAHTLGGSVGSIPQTLIGGGGGSHGNSNGALNGIHAT
PATNLKMSEAMRNAQHDTSPNPVSSKMKASKSYTHGLSSSSGTVNIPTSTSAQSNLSLLADISPNHTHFFEVMYVGKIRV
SQKRVPNTFIDDALPKFKAYDAQRLRLLQNRKMSLSSEGGVGIEAKPSSSLKSHDLKEEDEEEQEQHKGHDDSQDSQAKP
LVQLQLTGAEEGAAPRPLEDNKENKSPEKRPLLRGQSQIELGHKEHSDGSQPLAANSQLEAPNVIVNKQPTPPRDQGVGT
GTASASAGPSQLHPNYAMDNIPKQRDRSASQGCIPPYVEQNRTMVFLVGRCDLRLISPDRKQVLLYKDFKDVASCVHGQK
SLDHFGIICRELNNDGYIGYVFKCQSEHVCDDIVAAIAQAFDTCAEQKKKQDTQIFSCEHCPMLWYHKLCTDVEGLSEKK
TQALILRRIETLSDDEQEIVWAKFCGSEKTNSPVAEQNQFLMMLLRAHCESRQQRHVHDTAENRSEFLNQYLGGSTIFMK
AKRSLTNSFDNLLKRKPSKDDIAVPSHNLRDIREGSAEPLGTQSPPEGFRSRSNTVGASPSSKPTAEQLKSPMMDIFIKV
GNSPKEAETHQGSWRQAILNSVVTPSKGLDSEVPTEFLSPMRKPAKRGKRDAAELRELWRTAIRQTIMLNRMETENAMLQ
ARQNENELKRIKLDYEEIVPCDKQLIERWEQIIERNSTQIGNKKDPKVLGHAIRTGVPRSKRGDVWTFLAEQHSMNTAPV
DTKRFPNFNTPYHMLLKHLTEHQHAIFIDLGRTFPNHQFYKDPLGLGQLSLFNLLKAYSILDPELGYCQGLGFICGVLLL
HCDEANSFQLLKHLMFRRNMRTKYLPDMKKFQLQLYQLSRLVKDHLPDLYVWLDQNDVSPTLYAAPWILTVFSSQFPLGF
VARVFDLLFLESSDVIFKFAIALLSVHKQQLLAKDNFEEIMDYLKTVVPKMEHTCMEQIMKLVFSMDIGKQLAEYKVEYN
VLQEEITTTNHHLEMLNREKTQNQHLEQQLQFAQSSIAQLETTRSSQQAQITTLQSQVQSLELTIQTLGRYVGQLVEHNP
DLELPNEVRRMLQQLDDLDRQRRKPIFTERKIGKSVSVNSHLGFPLKVLEELTERDELGSPQKQKKEKTPFFEQLRQQQQ
QHRLNGGGQSSNVGESGSPTPPSRPNRLLDNASARTVMQVKLDELKLPEHVDKFVANIKSPLEVDSGVGTPLSPPSTASN
SSGGSIFSRMGYRTTPPALSPLAQRQSYGVAITTAPCPQHMEEVAPATTMAVMPQEDVEEPQPMHPLSMVGGDVNVRFKG
TTQLKSIRPVHHMRAIPLGGVQHPSSTEPAVRVAPVPVELAPPAATATTGRS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302091
6225
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302090
5465
FBtr0302092
5372
FBtr0334947
6315
FBtr0334948
5210
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0291300
1379
FBpp0291302
1406
FBpp0306963
1518
FBpp0306964
1352
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42612-PC
plx-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)