Polypeptide Dmel\Inr-a-PC

General Information
Symbol	Dmel\Inr-a-PC	Species	D. melanogaster
Annotation Symbol	CG10228-PC	FlyBase ID	FBpp0291319
Associated gene	Dmel\Inr-a

Length (aa)	86	Theoretical pI	5.68
Predicted MW (kDa)	10.2

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Inr-a-RC FBtr0302109 819
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Inr-a-RB FBtr0301513 2647 Inr-a-RD FBtr0302294 6321 Inr-a-RE FBtr0302560 5979 Inr-a-RF FBtr0339985 6012 Inr-a-RG FBtr0339986 6297
Other Polypeptides
	Name FlyBase ID Length (aa) Inr-a-PB FBpp0290728 573 Inr-a-PD FBpp0291500 1953 Inr-a-PE FBpp0291716 1839 Inr-a-PF FBpp0309006 1850 Inr-a-PG FBpp0309007 1945
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001163154 DDBJ / EMBL / GenBank • ACZ94426
Synonyms
	Inr-a-PC Pcf11-PC
References ( 0 )
	No references are recorded in FlyBase at present.