Open Close
General Information
Symbol
Dmel\Bili-PD
Species
D. melanogaster
Annotation Symbol
CG11848-PD
FlyBase ID
FBpp0291379
Associated gene
Length (aa)
828
Theoretical pI
7.44
Predicted MW (kDa)
91.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEPNHYYCRSAMQQNPSTSIPQHASNKLNYGMNAGQDYVTCSSGQSQSGYSSKDLVPRSGNSKTLGGNGNMGSPYGGSVC
SNSGQCSKNTANAGNYINIMTVPLGTLQYNRKKLSTQDYESHLYYNTTDVKCRDDYYIANNAAAAIPQHQAHQPHQQPHQ
HQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQQANFLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPPDAFDNCAIFPS
AGGSSNGSGRVAATQTHQNPSGVVTCDQQVPVSLGSVNMPVPPIMYTVHRVVTTAQIQTAAGSTFASSASVSSVVSTGQN
DGDCLSPAQVSSAMAASGNASCLGGLPDMGANMMSNASALCPLSDLRSPSGVLTNSSYMPQHHKCNNGNDAQSNPAIQKR
LMATSSTSNFATAGKAASNLTRALQNVIPTCVYLMSRVAVHMEIEGTAQCPSQVMLAAALGCEELGISNKLLAQSVFGLW
MTSALLEMQLKAHHCPYIVRVAWPNLLQKFSNSSPSDRKFDEPMIVLKRNVFFSKRDEEKIKDHRILELLYEEARNNVLT
GRYIMEPVHSLMLGGIQARIELGPYNSHTHTIGFFRENQARFLPPHVAKSSTWLWLPISQKNSAEVKLLEQFKRVPQTAT
TRKLMRKYLEFCWALPFYGAAYFHGQIEQPVRGIMALVNQKDMEVLVAVNERGVFVIDPYECTLLLGLRYEDLSWDYAKP
SASDDPECLTCIFLQFDAVENGIQVSKLMQIFSKQAAMIDALISHFTDQIRNKKQEGNTQEPFHDEPNPIQNNGNGVLCN
KLSRLTLATFDEEGGRCIGQMGSLSISY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302169
3750
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0301670
3858
FBtr0302168
3761
FBtr0302170
3845
FBtr0302171
3781
FBtr0302172
3901
FBtr0345299
4154
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0290884
828
FBpp0291378
828
FBpp0291380
828
FBpp0291381
828
FBpp0291382
828
FBpp0311466
828
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Bili-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)