Open Close
General Information
Symbol
Dmel\Fhos-PD
Species
D. melanogaster
Annotation Symbol
CG42610-PD
FlyBase ID
FBpp0291739
Associated gene
Length (aa)
1509
Theoretical pI
8.63
Predicted MW (kDa)
169.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIVKMEPDELITFRVQYLVDSDPLSACTAFPIPVRAPTYAFATTMPLANQLGTILRLLNAPQSIDDAAIQVYKDGDYGAY
LDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCL
VRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYAESNCYVLVSAIH
AVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLD
QLQLYEAVLKFEDGESDGQRLPQNSMRKTQRYRPGANTTERRKSRRHSTDNSPASLTKVLPTTVLRMTPTQATVDEDSSG
STNSTEFSGGLFNEKKPRDGAGVTPGLRRRRERAERHKSFLKEQQEAAANGIFAALEQREGLGQIVTAIPATIQTGDSPP
QSLQHEVPPCNNISGITNISNNNVSNLSCNDTPNNSLLVMSPSKQLLTGSHSISIINNSFDKASNNNQSEFLTKKNLFRE
RNSTVINGIMKNIQQTDSAYKKYENEANRLNNYYSQSPKHQIHQPIQPTPEVLLSPKKTLNASGFDFTPAPLSSTPVKCD
VPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPGWWHAPIYNSPQARTLTSTNPELLPHPVDPSDMESEDQQLLLQLKRDH
TVKDLTQKLSNLPMSPTQDSANRALVGDMSGLISKAKEGLAKSKSKGEISRSSSVDQDVKKSEPKKSENELHWEELVRNM
TRPLNLCDLDFTDLRDDDEKDVLAPRSLGAGIPPPPPPLGGAIAPPPMMPPSLAPPPMYGYGGSLTNSVNSLNGSINGEL
VNGNNTIKKNKKTVKLFWKEVREDMIPQVVGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKR
SNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLLNMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEA
RLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSL
LHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLKQKLVDFLADCAER
IIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMA
KFKTKDDVADDELKKLLDTSSADQADGTLTWRRRRAEQLRSPITRQSEEQFTDGDDEILESLVKTATKAPGTRTTPRERK
RTRHADRKSCKLTAQVIRLRSTSKTPIERIRFNEKVLVYIFSNRTQRAMSITSSWILSTRNTHYTIKNSTEKLLYIVIQI
LISHTKFQIYTSTCSFPYLFTIFSRLRSFCPLSFASLRICCLYWVLIYFHFVLLPLTHQSNKPIKNQIK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302583
5622
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302085
5027
FBtr0302086
4347
FBtr0302584
5159
FBtr0306630
4838
FBtr0306631
4304
FBtr0306632
6029
FBtr0333888
8968
FBtr0333889
8444
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0291295
1393
FBpp0291296
1294
FBpp0291740
1387
FBpp0297585
1205
FBpp0297586
1152
FBpp0297587
1744
FBpp0306020
2528
FBpp0306021
2528
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Fhos-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)