Open Close
General Information
Symbol
Dmel\CoRest-PC
Species
D. melanogaster
Annotation Symbol
CG42687-PC
FlyBase ID
FBpp0292001
Associated gene
Length (aa)
273
Theoretical pI
6.97
Predicted MW (kDa)
30.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVLAERNTTDVVRNGRRSRGPSPNTHTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGK
SKAKQSEYEEKIRVGRDYQAVCPPLVPEAERRPEQMNERALLVWSPTKEIPDLKLEEYISVAKEKYGYNGEQALGMLFWH
KHDLERAVMDLANFTPFPDEWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKAIK
AVVKDGSENGSEVGSNEESDNDDKIIAVPAHIS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302861
1800
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302860
1839
FBtr0302859
2085
FBtr0302862
3290
FBtr0302864
3296
FBtr0302863
3998
FBtr0307901
3155
FBtr0307902
3255
FBtr0307903
2203
FBtr0336667
1834
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292000
273
FBpp0291999
273
FBpp0292002
588
FBpp0292004
590
FBpp0292003
824
FBpp0300335
824
FBpp0300336
824
FBpp0300337
336
FBpp0307648
268
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42687-PC
CoRest-PC
Name Synonyms
Secondary FlyBase IDs
  • FBpp0099548
References (0)