Open Close
General Information
Symbol
Dmel\CG10702-PD
Species
D. melanogaster
Annotation Symbol
CG10702-PD
FlyBase ID
FBpp0292333
Associated gene
Length (aa)
946
Theoretical pI
6.80
Predicted MW (kDa)
109.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHCGNMLLGVGLMFLALYVPCAESKKEHECTSIDIRNECKNMHLLDNCTVVTGYVMITLITIEQRCNFSEYSYPLLTEIT
EFMIFTDVRGLVNITEMFPHLTVIRGRRLFLNYALGVTNMHELEQLVFPKLVAIQRGQVYIGSCPKLCSIGRVNWDLLTL
TRGENNIIMVNKNCSTPVCSGCSSSHCWSNHYCQRSINENVANPKANINACHEECLGGCKNNSSSPADCSVCRGLSDDGV
CVKSCPKDKYVMENYQRCYTKAECVLKHGYVISGSQCVAFCPSGYKTNNRSECVLCSPDEACISFCTPEWPGKAFTVYNL
ADAENLRGCQIFNGSLVITIRNKVNETQLYQSFTSMREVRGHVKVYRSSQLRSLQFLRNLERVHGDPLENRHYSFILYDN
KELSELWTPSRQLEFMEGGMFMHRNNKLCNRRMREFQNAVTHDRALDSLQTNDQEVQCSPLKLQLYVQKRTHRSVKLSWL
KSQTSQKIELIHRPLLPGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDLQPDTRYVVLLRTFGNDEAH
EAYEARSELTYVQTELDIPKPPLLELVKKTDSSLTVQMASHDHVSFLLTVFELSDDQDYIEQRNYCHQPSYVWQDMDGPR
WMAYEDYDDCCAQKAEQFEDSRFIADMREQYRCTLDDREQCRRLAHTEVSLPQLRLPGNTTEYELKALHRYRLYALQLQA
CNPLGCSSHTTLYGRTNYTMGADLLTQLYACHIPEMDKYIMRFEEPKKPNGLVTNYVIHFRNNFSQTHVGCVTRMDHQSA
GYMYVKQINITFTECAVRVHSLAGDVMTPYMPISLCSDEDRLQAFHSREAKDLSPEITDLPATASHGRGISIFLICFLFG
CSVSLVWVLYKRRCWRKLPGLRRYVPVREQWLRDRQQTEDREILVDGFETVRFQNNNNSQADDYPM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0303241
4041
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081175
3934
FBtr0081174
4145
FBtr0081176
3893
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0080717
946
FBpp0080716
946
FBpp0080718
946
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG10702-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)