Open Close
General Information
Symbol
Dmel\aPKC-PG
Species
D. melanogaster
Annotation Symbol
CG42783-PG
FlyBase ID
FBpp0292492
Associated gene
Length (aa)
951
Theoretical pI
6.85
Predicted MW (kDa)
104.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAWGYWSATTVDRGRSPRRLTQCAPLPVNIVQQEEEEEQPCLPQQQQHQQTQQQQQSQTCPSTPSANQQGSGNLCYSPTC
RSRCSSPCPGSPCGSITPPPPPMLTSSQQHLHSNKNCPAAQQLMTHLDYAARRQSLDQLDSPQANQLSDIMCRGAVVSSI
QSANNTLTRGVSMHSRSGSAHGSHHGSHHSHSHHGSAHGSLGCLQGGVGVGVGTGSTGSIGMMSAGHIDTGDYDVPHPHP
YTHHYMQTTASVTPPHTSLSRPGSAGAVCQGHDSGSDSSQGCGGSIMGGMLVMGHPGHMGSLGHHSAGSGSLGRCSSRCH
NTNTTTTDDSGGGSSGGGGVPGTMSSASMAVGMPGMLMDYHHSHHSGSAGSGLNGCGGGSIAGGSIGGRSSVLGTIHNGH
GHHHQQYHHECIHYERLPIPVPIPTVPMGVAPSSQQMSQHQLQSEEEIEPAYATVFPNVPQAPGLSCDGEDRSIYRRGAR
RWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHCTDQPEPLVKERAEESSDPIP
VPLPPLPYEAMSGGAEACETHDHAHIVAPPPPEDPLEPGTQRQYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVI
KKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLA
LNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYE
MLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNM
DWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0303435
3560
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0303434
3240
FBtr0303429
2075
FBtr0303430
2392
FBtr0303431
3320
FBtr0303432
2069
FBtr0303433
3023
FBtr0303437
2191
FBtr0329887
4573
FBtr0329888
2863
FBtr0329889
3023
FBtr0329890
2964
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292491
606
FBpp0292486
526
FBpp0292487
606
FBpp0292488
608
FBpp0292489
524
FBpp0292490
503
FBpp0292494
511
FBpp0302921
958
FBpp0302922
519
FBpp0302923
634
FBpp0302924
620
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42783-PG
aPKC-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)