Open Close
General Information
Symbol
Dmel\Sik3-PB
Species
D. melanogaster
Annotation Symbol
CG42856-PB
FlyBase ID
FBpp0292994
Associated gene
Length (aa)
1471
Theoretical pI
6.75
Predicted MW (kDa)
158.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATTPTAGPAAAPPTSSTPQNYKVPSTSKISVDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEE
YLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVV
HRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDG
KTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSAS
TSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKLQQRRRENQRLQHHASLAYSRSRKT
SITTGVVDRSEPVKQESLDRLSPLSNANASSSALGFGWSDVAVDLEKYGDFELECLARSNDPPVNAQHLSAHAGGGVNGA
NTRRHTVGPGDVAHEQALANPNVPPIDFKCPPQCSDPTQPVPYYPVNLPMLQNQPLHNLTIKDQHLLKPPVVMGASSFGR
RASDGGANLHIYYPATGTVVGPAQGQQMDTAGYYINPNCGTDPLAVQELSPLNEQSVAQMQCCQENATGECNEELQSYMQ
KRGGTQRHTVGCTEDLSVAHGSGAGSQSQAPTTSSNMRQRRTGLLTVTERPPVIPPEIIREVESRMKRDYLPPTLKSLSQ
SPPNGTYPVGAALPMGMSKGLSPPHSLPLVAAAGGSVPLVAPNNRRIHRVVHSKLPTVQEGATIGRYSPVRRASEGSKSQ
FQGPLQECQSLQKGIAQRNFLVAPSPPLLENSISLPGSPIHGKPGMGLQLALRRGHDIEVPPEAIKNLMPALDRLVKEQR
VSFEIANKIISTHVVPMDLAPLLGLAAHASSAAAVSGGHLDQSHFTHLQQQQQQQHMLSFSVSPLSMPQGGAVNASLTSA
KQMFGQPICGYTQYQPMTLALQPQHQQQLVGQFSSINLGASNSNSSSGCQSPVFSTSFSGSCSPNPYLPGAAGGSSPLHQ
ITKGISGLSTGCAGGSITRGTSAASEGAAAAAAANQPLDLSMDVCGGVMDQQPTDYAATNWFMPTASYYDMKPLNLSPAQ
PVRVVPTPPASPNLCIIQEENGNGQMCHTISTGTPYAGCTGGITPQICLTDVQGSEITLVALSSDNSRDSEDSLEQHTPV
MSLQGLIITEPSSDMPSITRGIGRKASLDCDSGAGSHCPVASGSSHANQSQTQAQTEAQCRRGSDKSLGFSDDSLSNDSN
NLSPCQEPSASSGFKSDSHSEMGDHTECGHLTPDSMCDSRRMSDEMCYEVPLPHECSNLDSTRILEMVKQTIDSTMPPKG
FVLHKGSISSEDSGAESRHSSASNASTSNPLACEAASLLASHSGYGEPTTNLSLEYSGGLQIELQVCEGRSRDHHGAGKG
IKLRRISGDQFEYGKICQQLISTITMQQVAG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304025
5637
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0304024
2983
FBtr0304026
6469
FBtr0340388
6278
FBtr0344258
6020
FBtr0344259
6011
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292993
702
FBpp0292995
1471
FBpp0309334
1468
FBpp0310663
1382
FBpp0310664
1379
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42856-PB
Sik3-PB
Name Synonyms
Secondary FlyBase IDs
  • FBpp0112007
References (0)