Open Close
General Information
Symbol
Dmel\Hsc70Cb-PH
Species
D. melanogaster
Annotation Symbol
CG6603-PH
FlyBase ID
FBpp0293000
Associated gene
Length (aa)
836
Theoretical pI
5.00
Predicted MW (kDa)
91.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNTVGGFKRLLGRKFNDPHV
QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAA
QIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIFVDFGHSSLQASACAFTKGKLKMLASTWDQIGGRDIDLALGDY
FAKEFQERYKINAKTNARANLRLLTEIEKLKKQMSANSTKLPLNIECFLDDIDVSSSMQRSQMEELCAPVLQRVEQTFKR
LLAESKLQLDDIHSVEIVGGSSRIPSVKQLIEQVFNKPASTTLNQDEAVSRGAALQCAIMSPAVRVREFGVTDIQNYAVK
VLWDSEGSAAPGEIEIFPQYHASPFSRLLTINRKGPFNVSIVYGQQVPYPDQTIGVWKVKDVKPTERGEGQDVKLKVRIN
NNGIVLISSATLVEKKEAEEAAAAAEQAASEEKPGDQTNNTGEPADGQQEAYCENEDDNNTSTASSPGGQGWAQRVKGWF
GSGADKKKKASKATELPLECTTHGFSPVDLSNYTQQESKMIGNDQKETERIDAKNALEEFVYDMRNKLQGGPFERYVVEA
EREKIVSQLNDLENWLYEDGEDCERDIYTSRLQALHQKTDPIKLRASDYEQGPAAFDELKNSIAIARLAVAEFRKGVPKY
DHLTETEFINISETADKAQSWLDANLPKFTQSPRTADSPVQISAVRQEVQTLNSCVSSVINRAKPKPTPAKTATPPKDEA
NAEQNGGEPAANSGDKMDVDNNGQSAAGNDPSMEVE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304037
3258
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0075771
3187
FBtr0075772
3162
FBtr0075773
3292
FBtr0304034
3184
FBtr0304035
3159
FBtr0304036
3283
FBtr0333051
3590
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0075513
804
FBpp0075514
804
FBpp0075515
804
FBpp0292997
804
FBpp0292998
804
FBpp0292999
836
FBpp0305265
804
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Hsc70Cb-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)