Open Close
General Information
Symbol
Dmel\PMCA-PS
Species
D. melanogaster
Annotation Symbol
CG42314-PS
FlyBase ID
FBpp0293013
Associated gene
Length (aa)
1255
Theoretical pI
7.58
Predicted MW (kDa)
138.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKT
FLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGL
QNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT
HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEI
TKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNL
VKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKL
CKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLGVKYQSIRDEITEDKFTRVY
TFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFV
PGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRP
NDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKK
ADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQM
LWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNAG
PTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFF
GIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRST
LEDLNERRSMHSLHSLRSPRTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQQ
QQRTLHNGLTSQRSSMPSNVPSSNQSFSKIAQTLQQKIRGNIETKHSNGQNETRI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304050
5939
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300554
4135
FBtr0300555
4740
FBtr0300556
4066
FBtr0300557
4053
FBtr0300558
4600
FBtr0300559
3857
FBtr0304046
4101
FBtr0304047
4017
FBtr0304048
4701
FBtr0304049
4065
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289781
1206
FBpp0289782
1255
FBpp0289783
1183
FBpp0289784
1206
FBpp0289785
1255
FBpp0289786
1120
FBpp0293009
1206
FBpp0293010
1194
FBpp0293011
1187
FBpp0293012
1210
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
PMCA-PS
Name Synonyms
Secondary FlyBase IDs
    References (0)