Open Close
General Information
Symbol
Dmel\CG10445-PD
Species
D. melanogaster
Annotation Symbol
CG10445-PD
FlyBase ID
FBpp0293247
Associated gene
Length (aa)
945
Theoretical pI
5.14
Predicted MW (kDa)
108.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MESSSPSDTTEIHKQSCSIQDQSSVPVPDSSGEINNWMEPEPVDSLELSGEYADNESAIFVSASEYNEKKAQIDQLVQKI
LTMEQQQRQLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQEIKIEDNSELVDHTEQPKWSNLYSGLNRY
RQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKWMQFRERQKISGGILADDMGLG
KTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQF
RILDDDDNDAGDKAVVEDEQKDLLAKTPEPEVFSSDEEEEHLSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNAIRVL
TFHGPNRHEIGIEAFRSYDLVITSYNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALT
GTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLNESMLGHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELICVQL
SKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERFLKSLGYNPGEKILGIYILV
LLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDVLAELDKFDETDSEDDCCDEEDSTRRDGNFKLEVI
KDEIKEENVPWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLTGTNDKIIVTSQWVSYL
AIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNEKRVLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRI
YRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTKCVGGGLNLAELKKLFEM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304704
3399
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300685
2985
FBtr0339711
2982
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289909
945
FBpp0308768
944
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG10445-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)