Open Close
General Information
Symbol
Dmel\nrm-PE
Species
D. melanogaster
Annotation Symbol
CG43079-PE
FlyBase ID
FBpp0293373
Associated gene
Length (aa)
2192
Theoretical pI
6.73
Predicted MW (kDa)
244.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGNMALRQSAKDVAKSNCVAVRSSISLSLVLVLCLALVDSSTAQVDTTISQQESQSVVLPCPVDAEKCGKLHSLNWFKGD
DRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFNGYRIELRVLVPPTEVVI
LDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPEVSWFRGTKRLTTYSPTHDLVDGLYTSTLELDWTLSREDLAQDI
ECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNLTWYNTTTIISSGENEITEVRSK
SLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEY
FANPASLTQVEWYRNDILVNVNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEIL
MIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLLKELPDCEETREDLCHIDPSKLLLESIGRGFFYNYSCEGF
NAAGWGPRSEDKELLVHYEPGPAALSHFPLVAVKKKSVTFSCSVDDPGFPESNRFRWLRGGRGPLQDIVTKDWTVEPVGL
DSRTNYSCYAYNEGGKGVMATVNLEVHAPPFFIKNLPPYTGILHSSPNATLTCRIECVPRCDISWQKDGVPIERNDSRYF
IKEKYMDASPATGDFESMLSVLHFNMPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRTYFGIEYAPENTTVSENIVYV
QEDTIPGRVICKSRANPEPSYKWIFKNETIANGNALIINTAMNRNDDGTYTCLAYNKHGSSIAKTVIKVQFKPRCEIERQ
EIDDQDTLICTAYGNPIEADFSWSIKTENETDENLGSGKKENSVEKSFYILQTDYAISRTYRCVANNTVGYGPFCEIEVA
EQLAWWQLWEKNTLIILVAAILGLLLTVIVICCIIICICRRRRRQDKYLTEVPINSIQSALSDQLDMSRAGRNLSTQDKC
TAILPNPSSSRFIGSAPKSPPRWPIRPGVMLHVSSNTKENLTVNRMTVKPNVSGNRGDMSQLSAQLSAALNGSRDNSDGT
ILTEISAVSGENEASNLSILEVTNRKKATVPSTIRNVSTAEGEIISSKTHSAGHIALDHVWSLIFKKSDDRTRDSQRSHV
GLLQTFWRGLGAKESTSGFESQHRLKGIRCSGSVTYKKAKETVHSTSDAASNGESSLTKRPNNCQPSVSIQLQSNMEEKT
SKFVLKDERNNSSTEVENIPCNMVPSITRGSSIESPQRPAPSSLPLKNFLNVTSWGCSGNSTMVPSHILANEQIHDKSSS
LREPLTEPGEYENLPFHGLQTAPNKFSTTPTNFNNNTNAVRVAQRPKELIGNINQPSVGLYQDCQATHDPLLYHQKYFCD
QDALNDQRSQYTTMHRPPNNVQYNQSLFKPDSNLQDQHNLSNCISKSYTEYYQQHQRSEKLQMIFPQGASKELNSNSLCN
TDHTPHSALVNINLRKYDRTEEELLGNMPRARHRKGTLNVENKFYSLKHLGGIEVRNQDLDKDYPIGGTTSSTPSATDDS
SLSKCKIHNSLGCNRLCNVGTNVQPMRVYDPPGYQNMVLERADDQITLSKKDECNLATVQTHTHPGKDKIKNHHHWIHQH
REKKDEGLGSDFHQLEPERISIYRSDSGISNSSYESQFSKPKMATLNSSSGPLVRKYAHRNIKVHNNVFNTSNVTESEAQ
LDDSSTLHQSCTVQSFAPSHCNRPQPRNRYSEETTKNECEQHQLGHQSLRPASTPSECISLDTSSRSEYIMSTVPAQSDS
VETPNEKIQMLAINPLLVKNWNNESYTGNKINKKQRRQTINNPYEHIQSHPYARPGDVCEVSRKAQSNSSEAFKTYNYGS
KSNSSAPQTAAPEHSKVKNATKICKKNGIGANREHYEGMLASKHIQGSRLGSLADIDDFPSQGPLNALVGNPADCLVARR
PIRLPLRKHHTFHFQSTQTANGKLQQLRERLQLQLHESRKVDQEKFPLVFDALELSEKHAFKPISPIPSLNNSAVQSTGE
QKQVDFPKHGSVRHLKGAEDDEDLGYSFCEEECVVENDINPTSDNLKTAPTNSSCSSTAVESANPINAQIFDDEFIYADL
ESQHYGPINYKAASLYSQVKKNKESGALDDLK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304833
7348
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0304830
4033
FBtr0304831
4067
FBtr0304834
4063
FBtr0304836
4608
FBtr0333221
8333
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0293370
1087
FBpp0293371
1036
FBpp0293374
1097
FBpp0293376
1209
FBpp0305423
1846
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG43079-PE
nrm-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)