Open Close
General Information
Symbol
Dmel\tweek-PG
Species
D. melanogaster
Annotation Symbol
CG42555-PG
FlyBase ID
FBpp0293467
Associated gene
Length (aa)
5096
Theoretical pI
7.33
Predicted MW (kDa)
567.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEALEVEDTSDDSLPMGFPEVGTWNSTHNVSLNDMNLDARMIWLLASLLTTITWVTYITFYNSRVIGMLITKIANRWFIK
GAYFKIGSVALNPLAGKIMFRDFVYITYDYTVRAQDGYFIFRWWRSYVPKDVSEDLSHSDTRLSVQLNGYELHIYNRSDL
YDTLEKTFGLEPSLLIPTDAASNEERNKLKEHHMNLENARQSQRIQNVKNSEAMQATTWRDLIPVIKIDVCSGRFVFGNR
LTPTTLSISVEEAHCTYSTKPAVCRLDHFMHFVKAKVENAKVLFCPSPKYTGLIDEPPRYMGEGFVVMMSNQMDLYFYMD
EPGVVPEHPVQIVLPNGDVVEPSPPVWGINARCLRGTDFSYGPWADRQRDHLYRYFYPSDWKEAEVTPTPQPGELRSYQS
FDVTLCVLNEATIDILFSKEKETNAMHITVGPASYVEMTIPWVTQPDGYTSKIQGQLFHVEATTSLQYRSLAEFESLEYK
VRIHYPTKWNAPQDWSISLSGCKTSAFIVYKHKCFFQDLIEDWANKARPDILSFVPYTCNFSIRLHEFEILMLCNEYNWI
DCSSANQENNHLAFCGDVFEMSFALPFDDFLPKTVTLKFWIHGEGLDLSLYVPEVSSVRPIVLAIDENARLLTREGKLIR
RPELYSKKWRKICQRSAGWIDCWAVPILALSIQYVYHPVPPLGPDPQADITTPEKEEILLSPMRIPKVRKSPVSSWQQPP
EQYSKFDPGTLAADHVTVELEIGSSVLMAYGNVLRNFISLKENIFGEDQNFTDMEQSNVNMKEPGVAQVNPKDQLLAKEK
ELANKSISETQPPEEKRKPFDPRLYRPLEVMVSVIVHDIQAHVMKNCNEDDPPCPVVLIERFGFEMNKKYHETTLQVLVS
PSYLLTSDCLQRSQREQHINQGHLMLSAVQVRGHAMFSNEGCALDEDTLEYSWLVEVQLGKLTGKLTLPQLVNVVTGLET
LILLAIDPENCLKSPKTVRNCHHGVPSNLCPQTKEEKKYKCPSSEDIKYKMTRVSVDAVDVYLIESGTALHAWISPIRLA
NCNLHGQRVKSGISGLLPSILLRLFMLHTTNSTFNTNTTGSNRSGKLRRADQDSLKSQDAGGSHYASHGKTGKRSSNSFS
RRDSREEATRKLRGSFSETHTKRTPETEITENWVEVGCTSLGPILLEGASALPIPDHELHLVQHNFLREHDAKFKRLWFL
WSNNGSALSSGSEISRCGCIGGCAFFGSNRNGQKFFKPTAQDAHDNYNIARYFIINNNKDFGFGESILHQGQLVFHTPPY
SLHCVSLYDTADFNGKGRLYRPAGDLRNGSLKKTDLCSLPDGTKFKIGASGTTGVEKPEPNCRNKSRESIGSPNTLERRT
KRYPCTRQTSVDVPYARLLDSPSKKLQLQHEASAGDAGSSHRRGSDSNRLRVSPPKTSISDSRLTGDVLDDETEIPDEMS
HSAPHSHPLEFEIADIALHVQGLGGDQLPREVQRTISLTSENPSEMFFSAEEDISNVLSQRGSMKQRNSVNSGSVVLSGK
KRFSSDLSIGAQNDNGSHTLPTYRSDLEIHAPDGNKTLPKRPQSTTELADSRGSSSGTPSLSSNSFISAMSSQEDVALVN
LHQQVNRPIIDSPLLMASYLNHLSQVKCFNWNGCSFPLGPDVFSTPLFSENEDGGLTYIGSKMLPHFDLYSCWREIKVVP
RYENATGSNSSATFMGGPKSHPWDPSVLLKEEESDKTTNGFDDGEFMSLQAEGGAVCTSVVARLKGQLNVFLTPLLLEGL
QRMVEAAVPTIQSMHLLSVVNFIHTSCIAKVNNDNILKRDQSLSYWSQVHSNSKRSTTERHLQGPGDSFLSDVYEESIST
KTQGLIVLPKVSITMLQSSIVEEIISVAALDNVQDLSCVSLLTFYMEGISTKFHMGKTTRASMHNVYIQQTVQSGSSNKK
GGIMKGTRALLAHLSSQTRPDNVQGEPILIETSEKQLEEVVITLDIGRAHAQLRRLKTEGQSCTQDSPIIVTAIPEHKSK
VLFECLKMPESTGIESIGYIMFECGLEGVGVKIVKRSHFEKSENSKEELAEMAGAGAGGGASAGGFNLNDLVGQGEGAAG
SGDGGATSKAEAAWRLITKKPPTPKTPKEKFQPASDSNISAETSGAEKGKSTPKPPDEDVEKGTSPANAQTGAQKPSAGA
GTNTKDNYDKVLSNVKETDKTSSCVIELKAVWFNFAAPPCVPITRKIDLTRLDWNLLSTASPAITAWMNPSNRLAMKIVS
LMKALHTRQTAVAACLMAEAMDNEKIQRNPKIKKVTKESRYANNYTLLSKTLQEDPSCQLCYIMQKLVLDEGVQRIETIF
KQHDVPHLNTLRQGIIVLSRQWKNTLYNPILFEHQYKNKLSRPINVTFSFPQNEEDAENDECEGDVEMGAFAGVGENPEE
SENALLLGQTQHHRTHIGATYGHEGANHGTASQRSTSTSPNIHHPRRGIQMLPIISGQVPEFEYGALQEGSLSSTNSVNK
SWLGTENHKEDLYFWMAKQQDNKKKHFTEKEHARPAPPKMTEHAGQTRSGIMQDSIKLLDAHLIFEPLLTCLGVMPQQMI
NKFSNADISSLENFGTNLSLIGTFDSIRVDIVVSEAGDKKNSAQKPAKLNKKSNGGRASIMMDTPLFLCERVGVELEVLK
MSDGMVDQARQNVIYMSRRQLKKHTSTVINFSLNVRFISQQVNMPLLRLLHQICNMYQNVKDAQNEFHDQPELSKKSQTK
DECSLASEPTDIVPFNSMSERYNHAENYSDERYDKFNETMPTMLARPRPGGLAPIIQLTPSPNAKNRPQSFAQKLRSTGK
SVKGKLGYTNLNESSSSPLRDSPTMSLHEHNILKMSTESKASLNGACATSVSGDYQNTLTKAGMPTMAPMLETPNCWKTI
YHLLELYGTMPETKTVVQRSSLNEHKSKSAGFAHDDDDLASAPTPLPQHREMLLVDASSQERTRLIVFGVAKIHKTRLLA
TLSGLKLESEITTLNSTATWRKKARPVSLECSLTGQVGRAMIVLLEGVAPSQQTVVKVTVGKSQTLYSSLSKRGKDKNSG
LLSIGAVNIDIPQHPVALHGMMTRSSKQLSSTLQELRVKRNSGRSTMRSHTAEEPESPFHARNSVGASSGTGVASEMRER
TVSGGAGAQQQPQQAARRAAHMAQSKTGTAQHQNGLLQPLVMQFNVLLQSLSINAALLPSLQAQYRMNHVSSMGVTGQRA
KFVIDLPTHTLSFNTKIQNEMNLPSEACIGLPPVHVLAEYIPDHRQDHTENVEGIVLRQGGYVNASAEIGEFERCLTTDL
LNHLVFVQKVFMREINEVLQKVYGGEKPVPLWTEESGDSSGAVQESSLKRILFSINISMKRIQLTATTPCSSAVRFETGI
LELQLSNRVKNLGDMSNRKLFFKAHIDFNLSLGQIIRNVIFDEAEPEFQQYAFFHTTINLRNAFQDELLNEDKELILLTL
KRPLVYVQPIAVDKAILVWLNYKNAYEYWAEKRANLCHEHAQHSLLSQYSGQHQNQNMQNPQVFDRVAFGQIAGSNLSTL
FLQLTVEDMGICLPLKQVNTTTFGSRSYQDFDAKGAVVITLENTIISACNSGALVSKGKFQGLCLRFADDFETNLDDWKP
NSAEPIMNVCVVSEGTFEVCSRTTAAKKGENAKWLLNVKWQMEGVDIHLDVNIGKQLSSLGHTLTMLTGFEEDETQMESP
DSDEGDQSCRDTFVRRRGDFDNLPAFVFDPTIDSKKRSFMMEKEMAEQLKIINDLRTLGASHNTVAHEERRLQELQAICY
KYFRRDMIQKWKRPSLRRSLKTYGRSHSYIGSGSSVSGVGVPQTLDNVSYTGRRLDTIASNDEISSLQSTPASCHSRSAS
LKHTTGGGVIGGGVNALGRVTFTEAMRQTSLPNADTDTETADNELDWRGDITPSEIDVDGTSVEMRRKHGHGQKQPEPNI
DFELDIKVLVNSGKCVLHTKDTGEERGYAGGSGAATSGVPASSVKSHKREKSIGNDWGSPTPSRRQRDKSKLRYNANALL
ADLTIFHIPGLDVKLHYQSKTLAEQLTGDQLPTGRRMGSKRATLCAWMTLQSIPEETIISPHILEFLEQTLEPIPARQSS
SVPPTPSHNTGVNLDILPANYVTYASFPVDVIVYFHMQPSTFRFSCLPVSRVECMLQLPSLDIVFSSKRSSEEENSAQPG
GHTQPDQQLPTGGLSVTGCLADFNVFIFHPYGGKKTSKETQFSPLSDSERKDSLSINVEFVKFHITRCRKVYIEPLPSSK
RSLDQSRAVIRFSTIVDIGSASFKYDMRRLTEILAFPKAWYRRRIVRRLFLGDLSVQQQQQQQQGNGAETPTGCPPATPT
PNEDASRAKDNMRLDFDGQPSQQQQQLGHFGAVRHLKNLGKSSSAESSGTPPSEKNQITAWETLVIFAVNFTKLNVQMNI
GNVCGNVVWLTKDFQSDGRLSIGSTGYKNMYAGIYLGGSALDAKGGIVGGSFEVNKINKRFHIKEEAGMEPYHTMGLSFM
ALELRLDYMGTSVLMTRISSFSAAMKDEWRTASQAAATPAHGKDQPRALIFIHGDLTWDQLQIMISKSTTADLLKMYFKL
EEFFTQQFKSSKRVFSNLEPRLQDRTASIKRRQQHKKKPANGELVAPPQIHGMIGENTDARHHRHWQKPLAQAVGLVVPS
LVTRLPRHGNVLGGTVELRGQNISLACFHGINFKSKSWALFSLRSPSINFATEARQSEDEVLVTQTLTSSLGQTTEVQQQ
QNHSMAIVSRITRNIIFPPQFKTLNEWFHYAFANSEIDAVDRFPMLECEREIASNSIERTRASGSSSAAKAQEHNHNREV
IFALPSLQLHFKTEHKQGPTTPEPSENKPEVLCSFITEFDDHIFVTVDADAFFFLHDLITSYVTEKEKVIGAQSARAASP
NLSQKANLKPYLTDEILKEKKGASNTNLTAQGKQTSGSKNSLDPLQGSHTSLANAAANMSGAATTNTTTTTTATTLSPGA
AAGGPSTSATNDSVDGKQQQQEGSPPTFDLESFVRDWRHFECQTWHLEPTVRLLSWAGKSIEPYGVDYILNKLGFSHART
TIPKWLQRGFMDPLDKVQALMMLQLLLMVRENKVERDSGASGSGKQQQQNHRPPTN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304928
16292
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0304927
16289
FBtr0304929
16352
FBtr0304930
16229
FBtr0340172
16454
FBtr0340173
16334
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0293466
5095
FBpp0293468
5116
FBpp0293469
5075
FBpp0309157
5150
FBpp0309158
5110
External Crossreferences and Linkouts ( 4 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
tweek-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)