Open Close
General Information
Symbol
Dmel\Cam-PC
Species
D. melanogaster
Annotation Symbol
CG8472-PC
FlyBase ID
FBpp0293502
Associated gene
Length (aa)
149
Theoretical pI
3.84
Predicted MW (kDa)
16.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDT
DSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0304963
5672
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088001
1488
FBtr0088002
695
FBtr0304964
3406
FBtr0345018
1435
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087109
149
FBpp0087110
149
FBpp0293503
149
FBpp0311269
149
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Cam-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)