Open Close
General Information
Symbol
Dmel\Cirl-PG
Species
D. melanogaster
Annotation Symbol
CG8639-PG
FlyBase ID
FBpp0293618
Associated gene
Length (aa)
1695
Theoretical pI
7.06
Predicted MW (kDa)
185.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSKYQTAYACEGKKLTIECDPGDVINLIRANYGRFSITICNDHGNVEWSVNCMFPKSLSVLNSRCAHKQSCGVLAATSMF
GDPCPGTHKYLEAHYQCISAAQTSTTTNRPSPPPWVLSNGPPIFGNGSGLIHPPGVGAGAPPPPRLPTLPGVVGISGNPG
LFNVPPQHTAVTHSTPSSSTTAVGGGRLKGGATSTTTTKHPAGRHDGLPPPPQLHHHHNHHGEDTASPTKPSSKLPAGGN
ATSPSNTRILTGVGGSGTDDGTLLTTKSSPNRPPGTAASGSVVPGNGSVVRTINNINLNAAGMSGGDDESKLFCGPTHAR
NLYWNMTRVGDVNVQPCPGGAAGIAKWRCVLMKRIPDSGYDEYDDDISSTTPAPSGGDCLHNSSSCEPPVSMAHKVNQRL
RNFEPTWHPATPDLTQCRSLWLNNLEMRVNQRDSSLISIANDMSEVTSSKTLYGGDMLVTTKIIQTVSEKMMHDKETFPD
QRQREAMIMELLHCVVKTGSNLLDESQLSSWLDLNPEDQMRVATSLLTGLEYNAFLLADTIIRERSVVQKVKNILLSVRV
LETKTIQSSVVFPDSDQWPLSSDRIELPRAALIDNSEGGLVRIVFAAFDRLESILKPSYDHFDLKSSRSYVRNTAILSND
SDVNAGEIQQRLRILNSKVISASLGKGRHIQLSQPITLTLKHLKTENVTNPTCVFWNYIDHAWSANGCSLESTNRTHSVC
SCNHLTNFAILMDVVDEHQHSLFTMFDGNMRIFIYISIGICVVFIVIALLTLKLFNGVFVKSARTSIYTSIYLCLLAIEL
LFLLGIEQTETSIFCGFITIFLHCAILSGTAWFCYEAFHSYSTLTSDELLLEVDQTPKVNCYYLLSYGLSLSVVAISLVI
DPSTYTQNDYCVLMEANALFYATFVIPVLVFFVAAIGYTFLSWIIMCRKSRTGLKTKEHTRLASVRFDIRCSFVFLLLLS
AVWCSAYFYLRGAKMDDDTADVYGYCFICFNTLLGLYIFVFHCIQNEKIRREYRKYVRQHAWLPKCLRCSKTSISSGIVT
GNGPTAGTLCSVSTSKKPKLPLGVSEEAHDDPQQQQQTPVPITEDAIMGATSDCELNEAQQRRTLKSGLMTGTLQAPPQT
LGGHVVLERGSTLRSTGHASPTSSAGSTHLIFAHKQQQQQQQQGPLGESYYHQPDYYSWKQPSTGTGGLKTPREYYNNAG
AAASSPQQAHEVFYWTQKPNSGHNGKKKRGAGGVPASPSGSLHSRTAAASQVLFYPSYKKTKPGQPTGYPQYAEALDPPL
ATGNAAAYYQQQQQLRRQQLHQQQQQQQQQQLSSDEEQAEQHAHLLHLQRRAGSQQQLPAPPPHMAQYQQEFMQRQYRNK
HSNCDLGMGDAYYNQGSVGGADGGPVYEEILSNRNSDVQHYEVGDFDVDEVYNNSVGTGVFNNMRAAVAAGGSRYGGGSL
SGGSVSSRSQQQQLKKQQQQQSLAQQRSARRCTADDDDDEDEEEDEEATAAEQLHDSVCDEDEEEDESDLEDDAHGLPPQ
SDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVGEGSLRGAFRQQQQQALNAKSPG
GRLAVNELFGHGNSGPPLPPANQTPAQKRQQLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML
DENNTVRCYLEPLAK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305081
7571
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0290112
6940
FBtr0301363
5860
FBtr0305080
3610
FBtr0305082
7805
FBtr0310448
7631
FBtr0310449
4305
FBtr0310450
4166
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0288551
1643
FBpp0290577
1639
FBpp0293617
932
FBpp0293619
1643
FBpp0302596
1711
FBpp0302597
1000
FBpp0302598
932
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Cirl-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)