Open Close
General Information
Symbol
Dmel\wap-PB
Species
D. melanogaster
Annotation Symbol
CG14614-PB
FlyBase ID
FBpp0293677
Associated gene
Length (aa)
343
Theoretical pI
5.36
Predicted MW (kDa)
38.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSSTAGKRKEIYKYLAPWPLYSMNWSVRPDKRFRLALGSFIEEYNNKVQIISLDEDTSEFSAKSTFDHPYPTTKIMWIPD
SKGVYPDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQPHARV
YVAGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTALLRLAWNKQDPNYLATV
AMDSCEVIILDVRVPCTPVARLSNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAEGEVNQI
QWGATQPDWIAICYNKACEILRV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305147
3077
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0077368
3025
FBtr0309240
2688
FBtr0339498
3366
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077060
343
FBpp0301179
343
FBpp0308582
343
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG14614-PB
wap-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)