Open Close
General Information
Symbol
Dmel\tyf-PJ
Species
D. melanogaster
Annotation Symbol
CG4857-PJ
FlyBase ID
FBpp0293712
Associated gene
Length (aa)
1911
Theoretical pI
6.67
Predicted MW (kDa)
199.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNNEQTPSSSDTPADRVASGGAAAKLPTIIPDTPIVSIAAGTMSESTTTTTVTKTTPTPFPQEQLMTMMSDHVAKADAQL
DEACRNQGAKDEDSQGAAPVAANHVATSGSSSRGNDPKKSSSPSNSHSSGNHAATADAAKGSAAEAAAGDTSFSQVFAML
KDSPSAELSRPNRRVLQYGATAKGKTQDDQNVGKRQKKKKTKYDTWEDSDFNDLDDASLKKLLEEAYWYRNPGDRKNKSE
RFLQMLKKAEYDEEISYRAIKSCLTINPSALTSSAATGSSGGSSSSAGHNSSYNSTNHRSTDPGQRHKQGGSLQDLVEAA
HRSELATTSAAAAAAATAAATQRFNCDYQLSGRSNRRQQQQQQQHNQNATSSASASKKIKNLNVSGRQREGGSLPSSVNF
EPASSAMEAKQNKQQAQPSTEAAGGSFSGSVGNKHHHRSSTGSCSSLITQSRDTEANNQFDLDMDDATGVGASAVVGASG
DQDDNMLEQLDPQNPSMKFLIDALNDTPLEARYTGAGKKFLIDDRLHFSVLELSARRKLQQQAQYLAALTGQFGLGLEEE
KRKVEAGYVSLNDNYTACSSVYGGGAGSPAAVEGSKPSTSSSAVSGGSNCGASSDALSSDLRPAKIGRMVPAAAAVAAAP
MGGKTTTRQLDENGNALGDGFGGSAASGSSGASGASAAASSSNGNGNANQFTALITPTVGSSVPTSTVAHRQNSVSTLLS
TGTNTTTTAMAAAAVAASYSQLQQAPVGGAAGTVSGIGIGMQQPTKQKTKKKSQQERNTTTVDVESVAGYRGNDPVEQLV
KYIENDVNGGGNSAAGQRKKERKKQNKLKKSNSLEELRTCSKMEVDDLKRQSATTEMMRHKKGTNNASSGGSSSTASGSS
NSGKHNSASVADINKNCNKEQQQQSTPTVQVRNSNNPGTQQRKGERRSWGTEELQYLGDHQEISAAWSELETVGQKELPL
ALPALARMSELDALNTVLSETAEFHVVTKKKKPKKQRAVTMDDAAVAAAAVTGGNLQRMQQITKSASSNIMSQRMHYYTP
YNSNNGGGSVNYKQQQQQSQQYQEHYQAPQGQHHHHHHHHHHHHHHHSGSAVSNQVDSSRRKSTSSMPPSEKSDSSDLDS
VHSLPIQTGKKKSLGGGNNKQRGAPSASQRQAKQNNNAAAPISYADIARNKQEALNNATASDTELELGDKMQIKSGGKSK
SRPDFPELPGAVTAVAASGGAANQATVVSSQNTPPSSSSSISYSQSLNATPPSSSSDAESTNSPELLAQVQIPAYSMITP
TLTASMISSVSSSVASTSSTSCSPPALQKSKSVEHDTSYSCNSSNLDQQYPALEKTVKRHSTNNVSVAVAASTSASASSS
LYNFAAAAKQQLTENTHSAVSPPAAVTTTSTAVAASAPAPTTVTVPAAVTVPCYSSSSTHGSTQTSTSTASSAIAALPSG
KAKAKPKELSPSSSCSKKPTKPSQDVPSISLSISTTPRATTSTSTTTTQKTTAATQTEGAKKLIGGIHKLPSSSCIAKGA
GAVLEATAGRRAVIILNDDREAGRSNNEFIFGDFNEDELKLFDDNLDDEEEGQHKQSSNKKQQTEGESDVTQDDTEDVDQ
DLDKELECLGRRPEKKQERQQDISASSDQHLNDSGAASDAVNSSASLDMLSISAEAAQSSPNAGATATSSSVASPINSST
PSGASSASASTSTSSSSVSISSSSGGNGAACLASVSGMLGGVANQSGDSGIYAAANTSIKEHVNTFLSKASSSEETLPSP
NSISMQQLETCNDIEAAIIAAARAAAAARSTSCSRSNSQEQDALQPQVKTKATPNPEAKMVLPVFVTYNNNNNDDDDDEE
DDESLQELSFMADLKADAATEDIAMQPPPPSCPAMMTNTELIVDYIAKTWNAIANSKYVTYYNEQEQEQET
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305182
6722
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070643
7079
FBtr0300931
9329
FBtr0301124
8145
FBtr0305179
8130
FBtr0305180
8146
FBtr0305181
6752
FBtr0305183
9545
FBtr0305184
5573
FBtr0305185
6082
FBtr0345713
10482
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070611
1911
FBpp0290153
1911
FBpp0290346
1667
FBpp0293709
1667
FBpp0293710
1667
FBpp0293711
1911
FBpp0293713
1667
FBpp0293714
1667
FBpp0293715
1667
FBpp0311757
1911
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4857-PJ
tyf-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)