Open Close
General Information
Symbol
Dmel\CG14071-PB
Species
D. melanogaster
Annotation Symbol
CG14071-PB
FlyBase ID
FBpp0293783
Associated gene
Length (aa)
136
Theoretical pI
4.53
Predicted MW (kDa)
15.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSRSAKGFGRLINPGVVLHPELHQKMADFEAMTIERSDLDHELSRLRKQQDDTEDNLAEALAEDEFQCNLSGQPFVAPNE
DELQEILRNHLGSIINKLAATYERLIYLDADIRKLKGVIEKAITVANEESAAAASM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305259
1225
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0080178
659
FBtr0340560
585
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0079767
136
FBpp0309455
136
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG14071-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)