Open Close
General Information
Symbol
Dmel\Nuak-PE
Species
D. melanogaster
Annotation Symbol
CG43143-PE
FlyBase ID
FBpp0293894
Associated gene
Length (aa)
2537
Theoretical pI
9.94
Predicted MW (kDa)
274.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVISKPDGTAPNGAAGGAEAAAPTGLDATGNSLAHPSGIPQDQIDNIMSGIANTGNVKMNNHRKKLRQRFDIIKKLGQGT
YGKVQLGINKETGQEVAIKTIKKCKIEAEADLVRIRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAGGELYDYLS
ERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLKLENILLDEKGNAKIADFGLSNVFDDQRLLGTFCGSPLYASPEIVE
GTPYQGPEVDCWSLGVLLYTLVYGSMPFDGSNFKRLVKQISQGDYYEPRKPSRASTLIRDMLTVCPRKRASIEQICSHWW
VNENDNVSCLDLAEDLANQTPVRLDVLLSLTPATITADQLVVPSAEGAAAAKAAANERVPRSHSVGSIRDMGPPNTEAER
RILDMVAAGGEAALMPSPTRTITPAQSPVQTKRKLQPTVSTENAAGTTAKKKEKPANSSFVISKDGAPLTEAPPTIIEPQ
ATLMEAETIANIPEEVPVPSYSQKDMQAVGDICDLLMGTATTPAPAPPAPTPVARQPTRGKLDAVVETPEEKDATKVIKK
FVNKHKTADLVNAINESASKAAAPVSAVAPPPFVRKCSLQDESTLNKFNAERRKSRILETAEKFQPPPPVAAAPPEKPKK
LSIPGVSVGSFKKEFEKKATNPPAAEGPTPGELRAQEQVAAAAAAAQEAETLSTPPPSPVVAQSLEGSDSKNSVASISLD
EARRSMENSIALLLQAQNESSKEVDQLCAQTETIGVSEPATQQERERKLKNARAIIGNAIQPASPGAEGPPTPPGAVKTS
TASITLKSATLPRRKINAKAEVQLDIKPRIPEQGAPPQPAMRFSTEMQHPVADLRSAPPREGPIPYSPIKTTLQARATSL
EPKEHVITIQRPPTQHAYGRTSSNTTTRSGSLSRQSTVESESEGTTTATNMSQATITSTSQPIKKSPREFIIPIAVEGGG
FITPRERSVEPSESSHTTSSRSTFTRLRPSRRIGSLLSEAGFDEGSPFQKMRTTSITRDGVSGGAEEEARFTPHRLRSSR
PVKKISQDNDSQSSNEEDDDDDDGFEILTAENLFSTLLQRVRALTNRLNVNSDLTAGFPSHSSRLLTDISRQAQSHSPFW
SPGSPFASRLNSSNSSGLGAPWRHSMSRDLGSDMESMFSRTGATLPRGHHQGKGKPSSAPAQVEKGAATVCSASTAKSEE
PLDLADLDLSRLRLSKKDLETLSSITPGLPKCFQEQLLAKLPPTQARKLSRTLSVQTSAPSSASTPKVYKRSQSSGRGYQ
PEQQPQEELAKPLTTDAPKTTSASTAIYRRSLSRSQAPTPNSGQDADSRAAPTPKSRSSSVCRDDYGKSSLCSSSTYTSD
ISEKYKYYSPYLSKSSNVSPSIASKDAPEKRYSGGLGRPPSGCLSPPPQLPQVAATEGTSSLRAGRSSQRRISRFLRPDF
FDEPRDRETQSMLREIREKSIDRQDQEQTQPQDLRRRKHSLPNVEQAEQPAETAPIRSSMRHSRNKSMELFTEAESNGQV
RDTVKTSTSRQRSVSKARELETELDKHELADKILQELQLLSAVRSQHEQTQESEKAEETSTIKKIKKLKPTESNEPEATK
IASTTTSSTTTLVRKVKKVVKKTDEAPKTTGSENADLASSAPKETKLKRPKSYPMKDLGLSLKSSTDLPEPTTSLLPTKL
PSKLPSGNTNESAVEPAPRESRLMRPKSYPATKLATPKELRKVTRSGVAIPTITEAIPTPSAMPTSTSSKSTSEEKSTSA
TPTGTMSAVTDAKDIVSSSSDSRPTTIKKIIKVSKKSKLMPPTPVTPTTPTTTATTTASTTPVESSKESSPVIKPKEKSP
EKKPSKGLLYALGQKFEKLRDSAMSKEKKAGSTGAAASLACTQKQGSPEERSSPEKYKKNVSDTEKSQQTGLSDDKRVDK
RSRFDTMLRSLRERSVPRSQPNGGVSPKRAASVEELHAGCPEGQGKQGGAVNKMFGGLLRRFDRESSEQRRVRSSRSTSN
IERQVREEQDQLLDASLPTSPIYQNVVKSTKSKVSSTANGEENCNCETACPDCRQNNGQNVTTSGAPTNTTMPSSKEKRK
GLMLDLASANVSASGAPSSVTTATTTTTSGSSYRGSKTNPALINGNGGLGMGIYSNLPPYPGAMKSASSNNSSSQQSMEN
ATNNNSTNTNNNCSSQTSGYRTSSAHEINRNNPLLTPSFENIANYSSDSRSYQDDCASTSTFLSPTEEPELYFDNWSICS
EDNYMLHATPSPTVSRLSRASLSSPTRCSESSDPNESVIDRIKRRSFYSRFNEQKKPRRTSSIVGPSAVRDYYREQQAAV
KARSSNKLHAPDMDPPPRAHSPDIAQQFFRPLKLSPVGTELKPPVYRSTLDYSASSAGATSKPRKSLNDIRNTSPSFLSK
RYETTDYSSVPMRYKSSSSSSPSNGAIASGYYNTYNPKRRSSYTLNGSLPTATSGSSAAGSSHLDGYATLGRRSLRPYDH
RTMSLLEPPTSSSSRSGEGVSYQRREARTPVRDYTSSISRSGSRYRTSSATRSPTNI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305355
8836
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0305352
4588
FBtr0305354
5076
FBtr0305353
4793
FBtr0305351
5997
FBtr0305356
5918
FBtr0305357
5566
FBtr0337049
5525
FBtr0337050
9381
FBtr0479807
9324
FBtr0479808
5177
FBtr0479809
8874
FBtr0479810
10122
FBtr0479811
9324
FBtr0479812
5975
FBtr0479813
5468
FBtr0479814
4727
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0293891
1427
FBpp0293893
1427
FBpp0293892
1427
FBpp0293890
1180
FBpp0293895
1532
FBpp0293896
1199
FBpp0307978
1551
FBpp0307979
2556
FBpp0428140
2618
FBpp0428141
1285
FBpp0428142
2537
FBpp0428143
2803
FBpp0428144
2537
FBpp0428145
1551
FBpp0428146
1532
FBpp0428147
1285
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG43143-PE
Nuak-PE
Nuak1-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)