Open Close
General Information
Symbol
Dmel\rudhira-PC
Species
D. melanogaster
Annotation Symbol
CG43154-PC
FlyBase ID
FBpp0294055
Associated gene
Length (aa)
2075
Theoretical pI
6.02
Predicted MW (kDa)
225.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSADSPRRHPSGVVGSGIGLGSGSGTGLGSGSTGGSKSGAAVPAIVPPQTVSDRSILDSAIGFINDVTLANQPVQDPKDT
ITWARFETCADVSDPRFGDDWELEGNAAPPLLLILGYGLGVQVWAIPANGEAVEVLSWRHGVVTALRVLPTPATAAALDE
NGRADEPVDSFAEKRPLVAFVDGGSAAASGLLAGSSGLGLGGGGGGVTTVGGSVGGVSGIGVSASAQFSAVNFMSLKTGV
QVKTIKFKNAVLDIQANRSAVVITFHERIAVFDARTLEDRLTITTCYPSPGINPNPIALGPRWLAYAEHKLLHSKRSGGG
CDGEGVPSYTATVLNAAKSLSKGLREFGEQVAAGLTGTTAGSGASSKSSSFDSASGGPDAKQSGVVTIIDVKHPVKDYSP
TSGTPLSSTAGSQGGGDPIVAHFVAHSEALVAMEFDSSGMLLLTADRRGHDFHVFRVQPHPVGPSLAAVHHLYVLHRGDT
SAKVQHIAFSLDSRWAAVSTLRGTTHVFPITPYGGAMGVRTHTSLHVVNKLSRFHRSAGLGADGRSSSPISHSESTTFVQ
SLQPYHNPTLPPYPRPSVVQPLAQLRQPFTLGSPPGSAGLGGGVGGGGVMGSGVSAGGHGVGVGVGSNSQRQRQRLSSLS
DDSGKPLSVCSIFAKSRSWLLEPPMATREQPHRVQRKAVDSLFVMAGHGALIQYDLDTKLASHVAKEKICDDTPIELEVE
ARAQWNLGRRKDGSQEIAPPLGLDNWLIKDRHASLLLDSANQFDDPDERTESWLAQVEIITHAGPHRRLWMGPQFVFKNY
NTPSGSNLNHVDAEAVEIGVSKTTTTTLPSTAASSALGLGTIIGKDRSSPLNMPLSAATSVGGAGIGSSAVTGRSGAGVP
VLIESGSYSSIEQSPKLMDRFRHGHLDSDYGHGDTRLKEDLADAMRESPSTAAARRETTAASVDQAAPPCGDHLATGASP
ASADLLAAGAGGSASSNCDNVCYYDALAEHESLNDLDEVVEDQHQHTDAETHLHSMDSISALASVLPNICSYSRVEKMVN
PLGTVTDLNAGISGELQTDMLDEVVGQLAAEDTVIHENCDEALFRPVVAIFCSDPAERQKLLQKDQKTEEATASELEREQ
ASCQPPVVLVNKLIVPVIAKEMDEVLVQKEKQKSQKQSHKAQQQQQQQQQQQKTLAAAEDAAQAQKFAELSHLNKPKGNS
NNNKTASQKSGSGTSEDEATTTITLAKSAKKAKNNKQKTSGKVSEKKPEQTNLAEEKVAVEKEENEERAVPMVKKTINKE
QDSDAESDHADSLLANKSSIAAVMVSSASAQGLSLHVEMSAADAEQGEDEEIEGLDEEPPKTMSKDNKKKQKPGDAVATM
TIDKEKEKAKEKELKLKEKEREAKLQEKEKEEKLKLKEREESLRMEREEKLKEEKIKEKEREEKLKEEKIKEKQREEKLK
EEKLKEKEREERMKEKEREEKAKEKQREEKLREEKIKEKEREEKLKEKLREEKIKEKEKEEKLRKEREEKMREKEREEKI
KEKERVEKIKEKEREEKLKKEKEEKLKEKEELLKKKEKEEKEREEKLKEKERQEKLKEKEREEKLKRETEERQREKEREE
KLKEKERAEKLKDLEKEVKLKEKEEQLKEKEKELKLKEKKEKDKVKEKEKSLESEKLLISATVSNPWRRVVEDTPPKLPA
VQDYPSLGKKPTKASPEKKRDEKLLPGLTTPPKEVNDTFEDFLSGLKPLEALPPLPALEPLEVKEDSKKESVSLINFESP
LQETASIPRKISPPPRGFTEQNLILALCGSLHYENEQERIRETEAEVQPEVVTTPEPVYITLDTLALQKSTSTSNNSSGS
EEIVVMEEPVKKLSKKHKRLKQLQLQQQQQQREREPDDEELRPLISISMCDSQLDVPDIPVRAMPDDDEGVEEEPETEPE
QSLPEDLLHFGSSGVATNATTTDSEGPVPATTSDDNVVYGSSSTSNAAPHKLKTKKLEHKINLIAAIEAATSSSTSSAEE
SSVETTVHPDPTGLGLGIGLQSHSPGAAVGAGSSTTGGATAASLPAAGGVTSVGLAVGVASPPSATKKKTKRRKR
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305604
8138
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0305603
5275
FBtr0305605
6807
FBtr0305606
9133
FBtr0333015
4335
FBtr0479991
9133
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0294054
1122
FBpp0294056
1122
FBpp0294057
2075
FBpp0305229
1122
FBpp0428278
2162
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG43154-PC
rudhira-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)