Open Close
General Information
Symbol
Dmel\CG43163-PC
Species
D. melanogaster
Annotation Symbol
CG43163-PC
FlyBase ID
FBpp0296980
Associated gene
Length (aa)
2523
Theoretical pI
6.73
Predicted MW (kDa)
270.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTNYENIINLPLNFNANNHAAGNNENNAKIAIVGEQLLNKMSQRDFSENEPECTPELPAANRALFLEKVRQSNAACQSGD
FATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGL
AQEPSNKQLMAGLVEASLKSPLRAALEPTLQQLRTMQLQESPFVVSSVVGQELLQATQYSAAVTVLEAALRIGSCSLKLR
GSVFSALSSAHWALNQLDQAIGYMQQDLAVAKSLGDTAGECRAHGNLGSAYFSQGAHKEALTAHRYQLVLAMKCKDTQAA
AAALTSLGHVYTASGDYPNALASHKQCVQLFKQLGDRLQEAREIGNVGAVYLALGECEAALDCHSQHLRLARKLHDQVEE
ARAYSNLGSAHHQRRQFTQAAACHEQVLRIAQALGDRSMEAAAYAGLGHAARCAGDASASKRFHERQLAMALAARDKLGE
GRACSNLGIVYQMLGSHDAALKLHQAHLGIARSLGDRTGMGKAYGNMARMAHMAGSYEAAVKYHKQELAINQAMNDRSAE
AATHGNLAVAYQALGAHDAALTHYRAHLATARSLKDTAGEACALLNLGNCLSGRQEYEEAVPHYESYLMLAQELGDVAAE
GKACHLLGYAHFSLGNYRAAVRYYDQDLALAKDAQHRPNMGRAYCNLGLAHLALGHTAAALECQQLFLAVAHATNQLPAK
FRALGNIGDILIRTGSHEEAIKLYQRQLALARAAGDRSMEAAACGALGLAHRLMRRWDKALGHHTQELTLRQELGDLSGE
CRAHGHLGAVHMALCSWTNAVKCYQEQLERAQEQRDAAVEAQAHGNLGIARLNMAHYEAAIGCLEAQLGTLERVSLPSTQ
ADRARALGHLGDCYAALGDYEEALKCHDRQLQLALGLTSHRDQERAYRGLGQARRALGQLPAALVCLEKRLVVAHELHSP
EIKALAYGDLGHVHAALGNHAQALNCLEHQRELAQGLQDRALESDAMCALGQVQQRMGQHAQALELHRQDLEICTELSAP
ALQARALSNLGSVHESLGQQAEALKCYERQLELSTDRLAKAMACLALGRVHHQLEQHNQAVDYLRQGLASAQTTGKSEEE
AKIRHQLGLALRSSGDAEGAHIQLETAAQLLESVRHEQRSPETRQALYDLQTTCYQLLQVLLVALNRNEDALVAAERCKA
RGGADAVSGEGSKVPLADSESIQETVDRGRTTVLYYSLAGDQLFTWLLEPHVGIVRFHAAKIDAHSLQLPLSLSEEEEEE
EDLEMERELKLNRDQNQDQSEDQGTSNKANRLLERYMSLVRDNLGVNSQSLLHEGDGSGWRASTEQLLEDLPGAGGSGGG
GFLRMVSRNQLLNSSNYSLSSLFSVGSVGGSVASLQGSTRSVGSRSSRRAPGLPVWRGPSCLHILYNLLLAPFDDLLPAG
EADTNRQGRRELVLVLDSSLYLVPFAILRAAQEDGEYLCERCAILTAPSLQSMRSRPRIRRDRARPPKALVVGGPRIPSN
LAELWGWAGAESPAALQEAAMVADMLQATALAGSNATKESVLAELPSAECVHFAANISWQLGAVVLSPGDVVTAEQQEQK
EPHEPQMTDFTLAAGELRQLRLSARLVVLSSYHSVEPITGDGVAQLAGGWLLAGAGVVLISLWPVPETAAKILLRAFYSA
LLQGARAARALAEAMQTVQHTKHFAHPANWAGFLLVGSNIRLSNKVAMGHALCELLRTPERCRDALRVCLHLVEKSLQRI
HRGQKNAMYTTQQSIENKAGPVAGWKDLLMAVGFRVEPAANGIPASVFFPQADPEERLAQCSASLQALLALTPATLQALG
KLVHVNSAEYAGDIIAVVRNILAQFPGSNPATGSSSTKSDAIAETCFIEMPLSVRLWRVAGCHELLASVGFDLTEVGADQ
VILRTGKQANRRQCQFVLQALLALFDTREAPKNLGLDRDSDHSSSCESLAEPEMDVASIPPAASSTPSVNGGNKAPLPLH
PRSAFISYVRRRGEPDGGRTDAIGGVGSGALDSSLANTTDSEHSLSDGYVTQPGFGLSNPRLGYASMRAPVRVSRPGGGG
ESDAAFTPSPPVTDPSLSLALAHQTRIRSLYSQTSSAAIVPPVATTLNRRPDSSSSASSTTDWEGSGHATVLRRGVSTAI
PQQQPPLPPPRPPTFHNLSVGAGGRSKPKIKLGSAQSSLAARVNKEHALFMDRLSVRTELSAPGSGNAMTSGSAARKPLA
LPEEEDVSNVVFNPSSLYFSQTDSDLLNEPKQEETPPPTKSSTKSLQDSMMRHMNRELTPSISEMYHDRNVGLGLAPPLS
KLLLSPNYEEQEVVSITEACPQSGANLKTLVDAVSELELSGSSSGATMPTVVGGGANEVEGTSGTSAEATCPICGEPADV
ICRCKAVTIQKKSILKPWLSNVPDSSLVQASELTTADILERRLEIHTATSSELRSGAPYSVDLSRRDEGDGRSVADSQCS
SNYKRVLASASGGALSLAGIGKGSEAEAQSASSGATCSSARLV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305700
7878
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0308608
7970
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0300832
2523
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG43163-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)