Open Close
General Information
Symbol
Dmel\Chd1-PB
Species
D. melanogaster
Annotation Symbol
CG3733-PB
FlyBase ID
FBpp0297122
Associated gene
Length (aa)
1900
Theoretical pI
6.41
Predicted MW (kDa)
213.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNFLYHLKPDKSKQFDPGCRALNESANSIGSDEQDDTREEANGTDHSGSGSGSGSSGSDSDSDSSSGNSSDGRSSPEPED
KSLSVAGFPPTAAAAQADSKTNGFTDDQEDSSSDGSSGSDSDSDAEGPSDQRNQSINNANTSSSLPKPEQNEEEDNETEA
GQQQPASDASADESSDSSANVSPTSSSSSSEEEEEDYRPKRTRQARKPPTAAEKSKKAPAPKNKKKTWDSDESDESEDSD
DEVSTAQKRKPAATTSRSKLAQQQQRRRVKPFSSEDSDDDDASKRCATRRKGAAVSYKEASEDEATDSEDLLEFEYDESQ
AATTAATAEEEEKCETIERILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDAETEAQFLIKWKGWSYIHNTWE
SEATLRDMKAKGMKKLDNFIKKEKEQAYWRRYAGPEDIDYFECQLELQHELLKSYNNVDRIIAKGSKPDDGTEEYLCKWQ
SLPYAESTWEDAALVLRKWQRCAEQFNDRESSKCTPSRHCRVIKYRPKFSRIKNQPEFLSSGLTLRDYQMDGLNWLLHSW
CKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEW
QFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWAL
LHFIMPDKFDTWENFEVQHGNAEDKGYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDA
LRKGKRGSTSTFLNIVIELKKCCNHAALIRPSEFELMGLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVR
MLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQ
ARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGA
EELFKDEQEHDDDLVCDIDEILRRAETRNEDPEMPADDLLSAFKVASIAAFEEEPSDSVSKQDQNAAGEEDDSKDWDDII
PEGFRKAIDDQERAKEMEDLYLPPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPTMK
EKITGFTDAELRRFIRSYKKFPAPLHRMEAIACDAELQEKPLAELKRLGEMLHDRCVQFLHEHKEEESKTAATDETPGAK
QRRARATFSVKLGGVSFNAKKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVDWGIEEDTKLLCGIYQYGIGS
WEQMKLDPTLKLTDKILLNDTRKPQAKQLQTRAEYLLKIIKKNVELTKGGQRRQRRPRASRANDAKAASQSASSTIDAKP
HDGEDAAGDARTVAESSNSQVDPSTASPHNAPATEQHGDPAKKAKKSKARSKKTSASDNNGNKPMHFTANNEPRALEVLG
DLDPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCLLQIGKQIDVCLNPYAETEKKEWRSNLWYFVSKFTEL
DAKRLFKIYKHALKQKAGGDGEAKGKDKGSSGSPAKSKPNGVTTEEKEKERDRSGGKKKKKDKDKERSGQARYPETGIPT
SGRYADPPLKRKRDENDADASSGLAGAPGGGIGDNLKSMSFKRLNMDRHEDRKKHHRGPDYYGGSGPPMGSGSYEGGSNS
RRQGPTSPSTPRTGRGGYDPPPAPSGYTPEMERWQSRDRYSQDYKRDRYDGYGRSGGGQGSYHRERDRRPEKRRYPSGLP
PHPYSSHYLPPNYYGLPNGAVPGLPPPSSVYRSDPRGYPVMPRDYPADYRRSDYERRTQT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0305980
6216
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0077674
6332
FBtr0331654
6463
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077358
1883
FBpp0304044
1881
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Chd1-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)