Open Close
General Information
Symbol
Dmel\Dap160-PD
Species
D. melanogaster
Annotation Symbol
CG1099-PD
FlyBase ID
FBpp0297159
Associated gene
Length (aa)
1190
Theoretical pI
5.17
Predicted MW (kDa)
131.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNSAVDAWAVTPRERLKYQEQFRALQPQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDSDGKMNINEFSIACKLINL
KLRGMDVPKVLPPSLLSSLTGDVPSMTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVISPPGVSVPSGPTPPT
SNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQSKLPQVTLAQIWTLSDIDG
DGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIKSRPGSVSGVVSRPGSQPASRHASVSSQSGVGVVDADPT
AGLPGQNKRKENYVKGQAELDRRRKIMEDQQRKEREERERKEREEADKREKARLEAERKQQEELERQLQRQREIEMEKEE
QRKRELEAKEAARKELEKQRQQEWEQARIAEMNAQKEREQERVLKQKAHNTQLNVELSTLNEKIKELSQRICDTRAGVTN
VKTVIDGMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERAKWEAKSKASGAALGGENAQQEQLNAAFAHKQLIINQIKD
KVENISKEIESKKEDINTNDVQMSELKAELSALITKCEDLYKEYDVQRTSVLELKYNRKNETSVSSAWDTGSSSAWEETG
TTVTDPYAVASNDISALAAPAVDLGGPAPEGFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEINGHTGW
FPESYVEKLEVGEVAPVAAVEAPVDAQVATVADTYNDNINTSSIPAASADLTAAGDVEYYIAAYPYESAEEGDLSFSAGE
MVMVIKKEGEWWTGTIGSRTGMFPSNYVQKADVGTASTAAAEPVESLDQETTLNGNAAYTAAPVEAQEQVYQPLPVQEPS
EQPISSPGVGAEEAHEDLDTEVSQINTQSKTQSSEPAESYSRPMSRTSSMTPGMRAKRSEIAQVIAPYEATSTEQLSLTR
GQLIMIRKKTDSGWWEGELQAKGRRRQIGWFPATYVKVLQGGRNSGRNTPVSGSRIEMTEQILDKVIALYPYKAQNDDEL
SFDKDDIISVLGRDEPEWWRGELNGLSGLFPSNYVGPFVTSEIKPDPGACSRRSKGIQRLWQQWRGCDIDQAAQHGDASN
NKLRGIIQAVHITKRRDGQLMGCAYVRFECNELLAKSMLQENGNQLVGKAVVVDWQPELPKKRFRQWRCW
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306017
4168
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081503
3973
FBtr0081504
3724
FBtr0301276
3970
FBtr0333086
5420
FBtr0333087
5171
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081031
1097
FBpp0081032
1014
FBpp0290491
1096
FBpp0305299
1088
FBpp0305300
1005
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Dap160-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)