Polypeptide Dmel\PGRP-LB-PF

General Information
Symbol	Dmel\PGRP-LB-PF	Species	D. melanogaster
Annotation Symbol	CG14704-PF	FlyBase ID	FBpp0297236
Associated gene	Dmel\PGRP-LB

Length (aa)	215	Theoretical pI	8.13
Predicted MW (kDa)	23.6

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAA APQKPHQSPPAAPKV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) PGRP-LB-RF FBtr0306099 1234
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) PGRP-LB-RA FBtr0082398 1129 PGRP-LB-RB FBtr0082397 1068 PGRP-LB-RC FBtr0082396 1255 PGRP-LB-RD FBtr0306097 926 PGRP-LB-RE FBtr0306098 925
Other Polypeptides
	Name FlyBase ID Length (aa) PGRP-LB-PA FBpp0081874 215 PGRP-LB-PB FBpp0081873 215 PGRP-LB-PC FBpp0081872 232 PGRP-LB-PD FBpp0297234 255 PGRP-LB-PE FBpp0297235 215
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001247054 DDBJ / EMBL / GenBank • AFH06372
Synonyms
	PGRP-LB-PF
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]