Open Close
General Information
Symbol
Dmel\Marf1-PE
Species
D. melanogaster
Annotation Symbol
CG17018-PE
FlyBase ID
FBpp0297345
Associated gene
Length (aa)
1272
Theoretical pI
8.37
Predicted MW (kDa)
143.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEHSDPVPYQQLSTLSPTTALYSNFNNSLEAGTAERLRLNKTGSQVHSLYVGDGQVQNASEPLSFPSHLNLYQYVRTPAN
FTINSRNRYIPYYNNRSYSASTTGFPIASTPLISSHAHIQDQQGAASYQTIVPLYQTASHCAQQHTTLASVAPIVDNSFV
ESTTCPMAGITSHNIKMKMIPPNVLLPCSRPTTTAVTIQRSTGEDGGDKEGHTFAKITEMSDAVTLQITNLDYSLDESHI
RSFLLNQLKPITPVVSLVFEGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVP
FNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTINSDNNEEKFISLNPELVNTLDISPLMEGLQHSVPYCSIHFKKEQH
KGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEELNVSIMANENGVNLEHLICCVQGIQVRANNFG
IKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFG
KQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFD
ITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHY
HFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKK
KYGYQIQPKTLGVMDMATAVELLPYVELKKKEQAIWLICHNNDHEFRFLCYRVCKYVMERDPSASVWTNVRGEVKLTKSQ
QFVKPIEKSILVRDFNAKYKDHLSESALLAMRQAIEVYDDGGIQCIRLTRFMKFIIAIVRMLEQRPSMYLYEIKNGLNCG
LSTTFEFGFPNLYSVVAAHKDLFSINNGPTQERSEVSINMNCELRQSSLSKDQCVLESQKLTNSKHRAQRSFHSHIGEHN
GLPISQPPLKRSATINNCSTFQTYHADTDIFNVPANCLPPRTNLSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSF
NSSGELNASLGAGDLTNISLGTGIAVDTSNEPSELWRRRQQNFNRPNSSNFRKSDNGTDGTYTIGNYIAPPIGSIYEPLK
YNGQDKEKLPFWIDPIWSKGSEQLRHDILNIRLPKARTTKTFSNILSPYTISKNENLKRQLFSFDNHDRKIA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306235
4815
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085956
4310
FBtr0085957
4395
FBtr0085958
4468
FBtr0306236
4749
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085309
1272
FBpp0085310
1294
FBpp0085311
1305
FBpp0297346
1305
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG17018-PE
Marf1-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)