Open Close
General Information
Symbol
Dmel\Hers-PF
Species
D. melanogaster
Annotation Symbol
CG32529-PF
FlyBase ID
FBpp0297488
Associated gene
Length (aa)
1456
Theoretical pI
8.74
Predicted MW (kDa)
156.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRLKETTKKSTPSATTSAHSHKTVPPSGGLLSTLHISPSLHQLPLSVQLQHQLHHQQQQQQQQPLQHPLPHQPHQLQHLL
HLQHQQQQQQQHQQRCSSVGSTSSSGTCETDRSYQSAGSCSSALSPAGGIGGIGGIMPGLAGATGDALGPAGAVAGSPGD
EASAAAALAANIAESFTFLQQHAAHHFRDILYAAHMLGRGYYQPAGPLISPHVIAAPPPPAQVKKLQEEDGPVSAAGSPT
QLQQQQAAAEAAAAAADQAAAQSQSQSQGQSHGHAHSHAHNPQQAQHPPQPQPYPAGAVAAAAAAAAAHQGVPYSRSMHA
AQMHYSTGYPPNYYAPYPGEVMCYSPPTYPPYFSSKVYQPSHPAHPAAHPQGPPPPGAYRRYPYYQHAGPPPPHELYEQQ
PPPPPVSSGSVSGPAQQQPPTSSPASVGAAGAGTAGAPSGSQLVPAHQQQHQQQHLEHYPGPPSYYAGYSPGGGASAGQC
YTRGLQGPYMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSSSCSSSMLLSATSNSNIGGGSSSSSSSSSSTTLPA
CSSATTTTTASALTTSRGPVKNVTPNNSNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTTSTTATTATTGT
QCQMLVKTELKGENPQVTKMQYEAHVMPPPTPPESYCASDEKLLDDQEQEAELELRLRLGLGLEKSHGGQQHIEAYDLTC
STPPPVTVPQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEPEMPFVLKAEIKAETKIKIEHDGEA
QASTHISQLPDLKPTIKTEPEQELEQEAASVPSVAKTEPQPEVEVEREQQEPPVDEEQQPTPGGSKQRFNLLALSSGNKK
TKTNNSYKSLIKQAEPKSYLCPGRRFIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVV
TPSLAGNPIEQAGSEVSIVKDQAPNSSATPSASPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQAPTAVG
GLYAASSPLTTATDHRGKQTTAEKRSKSETKKPPSGESSESGLPCKKPRKEPAGKVKGKGKKTTAGAAATTIASTAETQT
EAVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTASQQQNQQHSDEQHQFLVPSQPATASATAALA
ATPPPSRQGQATHTKRTRSRCKFGNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLV
LRTCYPAMRHVEGDIIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASR
HRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELVMFCRRAYEFRTR
RLLKLPHKNGLVCSSS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306521
6603
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074800
9826
FBtr0074801
5874
FBtr0100839
8024
FBtr0306520
9896
FBtr0306522
6524
FBtr0306523
5631
FBtr0332993
11220
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074569
2529
FBpp0074570
1280
FBpp0099783
1456
FBpp0297487
2529
FBpp0297489
1456
FBpp0297490
1139
FBpp0305208
2529
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG32529-PF
Hers-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)