Polypeptide Dmel\Fer1HCH-PF

General Information
Symbol	Dmel\Fer1HCH-PF	Species	D. melanogaster
Annotation Symbol	CG2216-PF	FlyBase ID	FBpp0297542
Associated gene	Dmel\Fer1HCH

Length (aa)	242	Theoretical pI	5.93
Predicted MW (kDa)	27.6

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MVKLIASLLLLAVVAQAYGDFKSKQESKSFVRELQREREEHQLKEKQNLS HEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMG AYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN VPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDY LTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Fer1HCH-RF FBtr0306587 981
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Fer1HCH-RA FBtr0085631 1677 Fer1HCH-RB FBtr0085632 1135 Fer1HCH-RC FBtr0085633 1227 Fer1HCH-RD FBtr0085634 1187 Fer1HCH-RE FBtr0085635 1197 Fer1HCH-RG FBtr0306588 1246 Fer1HCH-RI FBtr0332170 1005
Other Polypeptides
	Name FlyBase ID Length (aa) Fer1HCH-PA FBpp0084995 205 Fer1HCH-PB FBpp0084996 205 Fer1HCH-PC FBpp0084997 205 Fer1HCH-PD FBpp0084998 205 Fer1HCH-PE FBpp0084999 121 Fer1HCH-PG FBpp0297543 242 Fer1HCH-PI FBpp0304479 245
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001247366 DDBJ / EMBL / GenBank • AFH06683
Synonyms
	Fer1HCH-PF
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]