Open Close
General Information
Symbol
Dmel\Srpk79D-PL
Species
D. melanogaster
Annotation Symbol
CG11489-PL
FlyBase ID
FBpp0297552
Associated gene
Length (aa)
951
Theoretical pI
5.15
Predicted MW (kDa)
105.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDDFGSTASDLEEATCPMQANATFSIDWRVTLLDHWLDLYLGYMNRLHMLLSLAGRLHLLSRHILGTLGQDPIFMGVLQG
SLLMLFLFLMHLLRLWSCGYAVERPLNPTPDVAKELSCDFNFVSEQEKRAAQEAATEALLEVEEKKRRKRFTKKRNCVSA
GPILIALRHQSKRPKHHRHAALPFEPVTPGEIILDTYLPPRELPLTIRLPQLAEPVKEEEVEYIELKSEPRGTLSTTDEI
YPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIET
AADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGL
DYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNT
SNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKS
SGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNI
LSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDH
KTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHF
TEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGL
KYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLEQEEFV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306597
3518
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078496
3760
FBtr0303599
3919
FBtr0303600
4365
FBtr0304724
4206
FBtr0306594
3359
FBtr0306595
4706
FBtr0306596
3900
FBtr0334748
4765
FBtr0334749
3930
FBtr0334750
3771
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0078148
749
FBpp0292632
802
FBpp0292633
869
FBpp0293266
816
FBpp0297549
898
FBpp0297550
965
FBpp0297551
1018
FBpp0306789
950
FBpp0306790
802
FBpp0306791
749
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Srpk79D-PL
srpk79D-PL
Name Synonyms
Secondary FlyBase IDs
    References (0)